Citrus Sinensis ID: 002728

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------
MSIKKKRRVLFCGAGGEDDDARVGGPQDKDDTETFSREEEGSQISISDGILPSLGVTARSCRRITLRRFIISPFEPRYRLWETFLVFLVFYTAWACPFEFGFLNQPSRPLAITDNVVNAIFAIDIILTFFLAYLDKATHLLVDDPKKIAWRYAKTWLTFDVISTIPSEAGRKFLPSALQAYGYFNMLRLWRLRRVSRLFARLEKDRNYSYIRVRYSKLACVTLFAVHCAACTFYLLAEHYRDPKGTWIGQTLGDFKQQSLWVRYVTSIYWSIATLTTTGYGDIHPVNTRERIFDIFFMFFNLGLTSYLLGNMNNLVVHGTARTRKFRDTIQAASSFARRNQLPVRLQDQMLAHLCLRHRTDSEGLQQQEIIESLPKAIQSSISHFLFYSLVDQVYLFRGVSNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDLYILVTGAMELITRKGGIEQVVGEAKPGDVVGELGLLCYKPQLFTVRTKRLSQLLRLNRTAFLSLVQANVGDGTIIMNNLLQHLKDLGDPMMEGISTDTEQKLARGRMDLPLSLSFAAVRGDGLLLHQLLRRGSDPNELDNNGRTALHIAASRGHEHCVVLLLEYGADLNIRDSEGSVPLWEAMLGKHEPVVRILAENGALISSSDVGHFACTAIEQNDLLLLEKIVHYGGDVTQLTSNGTTPLHVAISEGNIEIVKFLIDQGSDIDKPDIHGWTPRALADHQGQEDIQILLQMKPEPKKAPVLTVPKKQQAPNPRKHLVKYSSEPSIPPYTPEVVSAVPEINLLNRHSRRRPNTFHNSLFGIVSAANTGEHSINFPTVSSYPPRVTISCPEKGQVSGKLVLLPKSLQELLSIASTKFGFTPSKILSKEGAEIDDVGLIRDDDHLFIVSDPAYGN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccHHHHHHHHHHHHHHHHHEEEEEEEEECccccccCEEHHHHHHHHHHHHHHHHccEEEEEcccEEEEEcHHHHHHHHccccHHHHHHHHccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcCEEECccccEEEEccccccCEEEEEEcEEEEEEEccccEEEEEEEccccEEEcccccccccCEEEEEEcccEEEEEEEHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcccccccccHHHHHHccccHHHHHHHHccccccccccccccHHHHHHcccccHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEECcccccccccEEEEccHHHHHHHHHHHHHcccccccEEcccccEEcccccEEcccEEEEEEcccccc
************************************************G**********S*RRITLRRFIISPFEPRYRLWETFLVFLVFYTAWACPFEFGFLNQPSRPLAITDNVVNAIFAIDIILTFFLAYLDKATHLLVDDPKKIAWRYAKTWLTFDVISTIPSEAGRKFLPSALQAYGYFNMLRLWRLRRVSRLFARLEKDRNYSYIRVRYSKLACVTLFAVHCAACTFYLLAEHYRDPKGTWIGQTLGDFKQQSLWVRYVTSIYWSIATLTTTGYGDIHPVNTRERIFDIFFMFFNLGLTSYLLGNMNNLVVHGTARTRKFRDTIQAASSFARRNQLPVRLQDQMLAHLCLRHRTDSEGLQQQEIIESLPKAIQSSISHFLFYSLVDQVYLFRGVSNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDLYILVTGAMELITRKGGIEQVVGEAKPGDVVGELGLLCYKPQLFTVRTKRLSQLLRLNRTAFLSLVQANVGDGTIIMNNLLQHLKDLG*******************MDLPLSLSFAAVRGDGLLLHQLLR************RTALHIAASRGHEHCVVLLLEYGADLNIRDSEGSVPLWEAMLGKHEPVVRILAENGALISSSDVGHFACTAIEQNDLLLLEKIVHYGGDVTQLTSNGTTPLHVAISEGNIEIVKFLIDQGSDIDKPDIHGWTPRALAD******IQIL**************************************************************************************TVSSYPPRVTISCPEKGQVSGKLVLLPKSLQELLSIASTKFGFTPSKILSKEGAEIDDVGLIRDDDHLFIVSD*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIKKKRRVLFCGAGGEDDDARVGGPQDKDDTETFSREEEGSQISISDGILPSLGVTARSCRRITLRRFIISPFEPRYRLWETFLVFLVFYTAWACPFEFGFLNQPSRPLAITDNVVNAIFAIDIILTFFLAYLDKATHLLVDDPKKIAWRYAKTWLTFDVISTIPSEAGRKFLPSALQAYGYFNMLRLWRLRRVSRLFARLEKDRNYSYIRVRYSKLACVTLFAVHCAACTFYLLAEHYRDPKGTWIGQTLGDFKQQSLWVRYVTSIYWSIATLTTTGYGDIHPVNTRERIFDIFFMFFNLGLTSYLLGNMNNLVVHGTARTRKFRDTIQAASSFARRNQLPVRLQDQMLAHLCLRHRTDSEGLQQQEIIESLPKAIQSSISHFLFYSLVDQVYLFRGVSNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDLYILVTGAMELITRKGGIEQVVGEAKPGDVVGELGLLCYKPQLFTVRTKRLSQLLRLNRTAFLSLVQANVGDGTIIMNNLLQHLKDLGDPMMEGISTDTEQKLARGRMDLPLSLSFAAVRGDGLLLHQLLRRGSDPNELDNNGRTALHIAASRGHEHCVVLLLEYGADLNIRDSEGSVPLWEAMLGKHEPVVRILAENGALISSSDVGHFACTAIEQNDLLLLEKIVHYGGDVTQLTSNGTTPLHVAISEGNIEIVKFLIDQGSDIDKPDIHGWTPRALADHQGQEDIQILLQMKPEPKKAPVLTVPKKQQAPNPRKHLVKYSSEPSIPPYTPEVVSAVPEINLLNRHSRRRPNTFHNSLFGIVSAANTGEHSINFPTVSSYPPRVTISCPEKGQVSGKLVLLPKSLQELLSIASTKFGFTPSKILSKEGAEIDDVGLIRDDDHLFIVSDPAYGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium channel AKT6 Highly selective inward-rectifying potassium channel that could mediate potassium uptake in the pollen membrane. Plays an important role in pollen tube development. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. May interact with the cytoskeleton or with regulatory proteins.probableQ8GXE6
Potassium channel AKT1 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. May be a major salt-sensitive potassium channel in roots.probableQ0JKV1
Potassium channel AKT1 Highly selective inward-rectifying potassium channel that mediates potassium uptake by plant roots.probableP0C550

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L6B, chain A
Confidence level:very confident
Coverage over the Query: 572-632,664-706
View the alignment between query and template
View the model in PyMOL
Template: 3AJI, chain A
Confidence level:very confident
Coverage over the Query: 561-725
View the alignment between query and template
View the model in PyMOL
Template: 3D9H, chain A
Confidence level:confident
Coverage over the Query: 546-636,669-725
View the alignment between query and template
View the model in PyMOL
Template: 2PTM, chain A
Confidence level:confident
Coverage over the Query: 320-499
View the alignment between query and template
View the model in PyMOL
Template: 2ETB, chain A
Confidence level:confident
Coverage over the Query: 512-641,652-703
View the alignment between query and template
View the model in PyMOL
Template: 4GMR, chain A
Confidence level:probable
Coverage over the Query: 549-638,670-725
View the alignment between query and template
View the model in PyMOL
Template: 2A9H, chain A
Confidence level:probable
Coverage over the Query: 210-254,267-320
View the alignment between query and template
View the model in PyMOL
Template: 3BEH, chain A
Confidence level:probable
Coverage over the Query: 78-132,147-250,267-312,333-354
View the alignment between query and template
View the model in PyMOL
Template: 3LVQ, chain E
Confidence level:probable
Coverage over the Query: 532-638
View the alignment between query and template
View the model in PyMOL