BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 002735
         (887 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1FFU|A Chain A, Carbon Monoxide Dehydrogenase From Hydrogenophaga
           Pseudoflava Which Lacks The Mo-Pyranopterin Moiety Of
           The Molybdenum Cofactor
 pdb|1FFU|D Chain D, Carbon Monoxide Dehydrogenase From Hydrogenophaga
           Pseudoflava Which Lacks The Mo-Pyranopterin Moiety Of
           The Molybdenum Cofactor
 pdb|1FFV|A Chain A, Carbon Monoxide Dehydrogenase From Hydrogenophaga
           Pseudoflava
 pdb|1FFV|D Chain D, Carbon Monoxide Dehydrogenase From Hydrogenophaga
           Pseudoflava
          Length = 163

 Score = 32.7 bits (73), Expect = 0.88,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 355 GFRSPIVVMKAAKSIEKNSNPASSAIQNESLSGYQCRAGRKESVEKRTKDPTQRSNYLQD 414
           GF +P ++M+A + +++N NP  + I+   ++G  CR    +++ K  +   ++   LQ+
Sbjct: 102 GFCTPGMLMRAYRFLQENPNPTEAEIR-MGMTGNLCRCTGYQNIVKAVQYAARK---LQE 157

Query: 415 PSS 417
           PS+
Sbjct: 158 PST 160


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.310    0.126    0.356 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,765,219
Number of Sequences: 62578
Number of extensions: 1058327
Number of successful extensions: 1676
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 1676
Number of HSP's gapped (non-prelim): 5
length of query: 887
length of database: 14,973,337
effective HSP length: 107
effective length of query: 780
effective length of database: 8,277,491
effective search space: 6456442980
effective search space used: 6456442980
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 56 (26.2 bits)