Citrus Sinensis ID: 002756


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880----
MRINETDGVSASSKHLVFAYYVTGHGFGHATRVVEVVRNLISAGHDVHVVTGAPDFVFTSEIQSPRLFIRKVLLDCGAVQADALTVDRLASLEKYSETAVAPRKSILKDEVEWLNSIKADLVVSDVVPVACRAAADAGIRSVCVTNFSWDFIYAEYVMAAGHHHRSIVWQIAEDYSHCEFLIRLPGYCPMPAFRDVIDVPLVVRRLHKSRKEVRKELGIEDDVKLLILNFGGQPAGWKLKEEYLPSGWKCLVCGASDSQLPPNFIKLPKDAYTPDFMAASDCMLGKIGYGTVSEALAYKLPFVFVRRDYFNEEPFLRNMLEFYQGGVEMIRRDLLTGHWKPYLERAISLKPCYEGGINGGEVAAHILQETAIGKNYASDKLSGARRLRDAIIFGYELQRVPGRDVSIPEWYQTAEDELGLSASRSPPCTPEGDSTVKLSTEDFEILHGDCQGLPDTMSFLKSLVELDIIKDSDRTPEKRQMRERKAAAGLFNWEEEIFVARAPGRLDVMGGIADYSGSLVLQMPIREACHVALQKISPSKQRLWKHALARHNDKGQGPMPVLQIVSYGSELSNRGPTFDMDLSDFMDEGKPMSYEKAKKYFDTNPSQKWAAYVAGTILVLMTELGVRFEDSISMLVSSAVPEGKGVSSSASVEVASMSAIAAAHGLNIHPRDLALLCQKVENHIVGAPCGVMDQMASACGEANKLLAMVCQPAELLGVVEIPSHIRFWGIDSGIRHSVGGADYGSVRAGAFMGRKMIKSTASGMLPQSLPSSNGLNNIEPEVDGVELLEAEASLDYLCNLSPHRFEALYAKNIPESIVGEEFSKNYGDHNDPVTVIDPKRTYFVRAPVCHPIYENFRVKAFKALLTAAASDDQLTSLGELLYQL
cccccccccccccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEccccHHHHHHccccccEEEEcccccccEEccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHccccEEEEEcccHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEcccccccccccccEECccccccccccHHHHHHHHccccccEEEEEEcccccccccccccccccccEEEEEccccccccccEEEcccccccccHHHccccccccccHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccEEEcHHHHHccccHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHHHcHHcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccccccccccccccccEEEEEEEcccccEEEEEEcccccccccccccccEEEEEcccccccccccccccccccccccccccHHHccccccccccccccccHHHHHHHHHHHHcccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHccccccEEEEEcccccccccccccccCEEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHcccccccEEcccccccccccccccccHHcHHHHHHHHHHHHcccHHHHHHHHHHHHcc
**************HLVFAYYVTGHGFGHATRVVEVVRNLISAGHDVHVVTGAPDFVFTSEIQSPRLFIRKVLLDCGAVQADALTVDRLASLEKYSETAVAPRKSILKDEVEWLNSIKADLVVSDVVPVACRAAADAGIRSVCVTNFSWDFIYAEYVMAAGHHHRSIVWQIAEDYSHCEFLIRLPGYCPMPAFRDVIDVPLVVRRLHKSRKEVRKELGIEDDVKLLILNFGGQPAGWKLKEEYLPSGWKCLVCGASDSQLPPNFIKLPKDAYTPDFMAASDCMLGKIGYGTVSEALAYKLPFVFVRRDYFNEEPFLRNMLEFYQGGVEMIRRDLLTGHWKPYLERAISLKPCYEGGINGGEVAAHILQETAIGKNYASDKLSGARRLRDAIIFGYELQRVPGRDVSIPEWYQTAE********************VKLSTEDFEILHGDCQGLPDTMSFLKSLVELDII****************AAAGLFNWEEEIFVARAPGRLDVMGGIADYSGSLVLQMPIREACHVALQKISPSKQRLWKHALARHNDKGQGPMPVLQIVSYGSELSNRGPTFDMDLSDFMDEGKPMSYEKAKKYFDTNPSQKWAAYVAGTILVLMTELGVRFEDSISMLVSSAVPEGKGVSSSASVEVASMSAIAAAHGLNIHPRDLALLCQKVENHIVGAPCGVMDQMASACGEANKLLAMVCQPAELLGVVEIPSHIRFWGIDSGIRHSVGGADYGSVRAGAFMGRKMIKSTASGMLPQSLPSSNGLNNIEPEVDGVELLEAEASLDYLCNLSPHRFEALYAKNIPESIVGEEFSKNYGDHNDPVTVIDPKRTYFVRAPVCHPIYENFRVKAFKALLTAAASDDQLTSLGELLYQL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRINETDGVSASSKHLVFAYYVTGHGFGHATRVVEVVRNLISAGHDVHVVTGAPDFVFTSEIQSPRLFIRKVLLDCGAVQADALTVDRLASLEKYSETAVAPRKSILKDEVEWLNSIKADLVVSDVVPVACRAAADAGIRSVCVTNFSWDFIYAEYVMAAGHHHRSIVWQIAEDYSHCEFLIRLPGYCPMPAFRDVIDVPLVVRRLHKSRKEVRKELGIEDDVKLLILNFGGQPAGWKLKEEYLPSGWKCLVCGASDSQLPPNFIKLPKDAYTPDFMAASDCMLGKIGYGTVSEALAYKLPFVFVRRDYFNEEPFLRNMLEFYQGGVEMIRRDLLTGHWKPYLERAISLKPCYEGGINGGEVAAHILQETAIGKNYASDKLSGARRLRDAIIFGYELQRVPGRDVSIPEWYQTAEDELGLSASRSPPCTPEGDSTVKLSTEDFEILHGDCQGLPDTMSFLKSLVELDIIKDSDRTPEKRQMRERKAAAGLFNWEEEIFVARAPGRLDVMGGIADYSGSLVLQMPIREACHVALQKISPSKQRLWKHALARHNDKGQGPMPVLQIVSYGSELSNRGPTFDMDLSDFMDEGKPMSYEKAKKYFDTNPSQKWAAYVAGTILVLMTELGVRFEDSISMLVSSAVPEGKGVSSSASVEVASMSAIAAAHGLNIHPRDLALLCQKVENHIVGAPCGVMDQMASACGEANKLLAMVCQPAELLGVVEIPSHIRFWGIDSGIRHSVGGADYGSVRAGAFMGRKMIKSTASGMLPQSLPSSNGLNNIEPEVDGVELLEAEASLDYLCNLSPHRFEALYAKNIPESIVGEEFSKNYGDHNDPVTVIDPKRTYFVRAPVCHPIYENFRVKAFKALLTAAASDDQLTSLGELLYQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
L-arabinokinase Arabinose kinase. Involved in the salvage pathway which converts free L-arabinose to UDP-L-arabinose. May play a role in arabinose transport.confidentO23461

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CZ9, chain A
Confidence level:confident
Coverage over the Query: 499-532,549-585,604-748
View the alignment between query and template
View the model in PyMOL
Template: 1PIE, chain A
Confidence level:confident
Coverage over the Query: 480-544,569-585,602-748,779-818,839-883
View the alignment between query and template
View the model in PyMOL
Template: 2A2C, chain A
Confidence level:probable
Coverage over the Query: 463-533,549-588,604-883
View the alignment between query and template
View the model in PyMOL
Template: 2IYF, chain A
Confidence level:probable
Coverage over the Query: 26-193
View the alignment between query and template
View the model in PyMOL
Template: 3TSA, chain A
Confidence level:probable
Coverage over the Query: 26-58,73-305
View the alignment between query and template
View the model in PyMOL