Citrus Sinensis ID: 002815


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------
MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI
cccccccccccccccccccccHHHcccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHcHHHcccccccccccHHHHHHHHHHcHHHcccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccccHHHHHHHHHHHHcccccccccccccccccccc
ccccccccccccccccccccccHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHEcccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccEEEEEcccEccHHHHHHHHHHHHHHcccccccccccccEEEcc
mgstgepdrkrrhfssisptaatakknpffpsseekkiDTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKErqqpydstLKVVNKSWEELITDLESCSmraressngqesrclsiiedvtphpshdaFLSRLMetgatesssadncpnqmeedretgiprtkNIVSNILAAVDNLWHLKGGLYAAVLKDlqdggskqkasSNLQSEVKNLRLALMDLHLKHKSLTRELqsrqdidaKDKAKLNRLKGELESAVKELEECNCKLAALRAerdvtkgaffpvlnlgnkhvagdrvrdeqrDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFrrssavtdskIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEdrsqnsanLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCsiclerpkevvitkcyhlfcnpcvqkvtesrhrkcpgcaasfspndvkpvyi
mgstgepdrkrrhfssisptaatakknpffpsSEEKKIDTAVLQFQNQKLVQKLETQKVEYSALENKFaqlkerqqpydstlKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGAtesssadncpnqMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSltrelqsrqdidakdkaKLNRLKGELESAVKELEECNCKLAALRAERDVTKgaffpvlnlgnkhvagdrvrdeqRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETElnmkidlvdvfrrssavtdskiadlgieiqkqideknriemrleeasrepgrkeIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHslkssldeqsLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAedrsqnsanlentqkrlsdvrkssvqvrgsleesqskvyksrlTLMELQIELVKERFAKKRLEEDLEMGRRKVlrlqaqtegssiIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRkcpgcaasfspndvkpvyi
MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMqtqnqqllqqITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSiieelqqelreyreilKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI
****************************************AVLQFQNQKLVQKLE**KVEYSAL****************TLKVVNKSWEELITDL*******************************************************************KNIVSNILAAVDNLWHLKGGLYAAVLKDL*********************LALMDL***********************************VKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVA***************************QLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQL***KSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQ************************IIAEFRALV***************KYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLK***********V**************************************************AYLSEIETI*************LLQQITERDDYNIKLVLEGVRARQLQDALLMDKHM****IQQANASLNFFDMKAARIENQLRFCLD***********************************************RLTLMELQIELVKERFA**************************IIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRH*KC*****************
**************************************************************************************KSWEELIT******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************EILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI
*************FSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCS************RCLSIIEDVTPHPSHDAFLSRLMET*********************GIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDL************LQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLEN************************KVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQK********CPGCAASFSPNDVKPVYI
***********************************KKIDTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRAR******************PHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERD*************************QRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDVTKGAFFPVLNLGNKHVAGDRxxxxxxxxxxxxxxxxxxxxxASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIExxxxxxxxxxxxxxxxxxxxxPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSDVRKSSVQVRGSLEESQSKVYKSRLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTEGSSIxxxxxxxxxxxxxxxxxxxxxERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query877 2.2.26 [Sep-21-2011]
Q8RXD6878 E3 ubiquitin-protein liga yes no 0.997 0.996 0.585 0.0
Q7XU27884 E3 ubiquitin-protein liga yes no 0.997 0.989 0.476 0.0
A2XW69884 E3 ubiquitin-protein liga N/A no 0.997 0.989 0.476 0.0
Q9C895900 E3 ubiquitin-protein liga no no 0.985 0.96 0.324 1e-123
Q336R3844 E3 ubiquitin-protein liga yes no 0.931 0.968 0.337 1e-120
A2ZAC2844 E3 ubiquitin-protein liga N/A no 0.931 0.968 0.337 1e-120
Q8CJB91002 E3 ubiquitin-protein liga yes no 0.396 0.347 0.310 1e-35
Q4R7K71001 E3 ubiquitin-protein liga N/A no 0.393 0.344 0.313 1e-35
Q3U3191001 E3 ubiquitin-protein liga yes no 0.396 0.347 0.313 2e-35
O751501001 E3 ubiquitin-protein liga yes no 0.393 0.344 0.313 2e-35
>sp|Q8RXD6|BRE1A_ARATH E3 ubiquitin-protein ligase BRE1-like 1 OS=Arabidopsis thaliana GN=HUB1 PE=1 SV=1 Back     alignment and function desciption
 Score =  987 bits (2552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/880 (58%), Positives = 665/880 (75%), Gaps = 5/880 (0%)

Query: 1   MGSTGEPDRKRRHFSSISPT--AATAKKNPFFPSSEEKKIDTAVLQFQNQKLVQKLETQK 58
           M STGEPDRKRRHFSSISP+  AA  KK PFF  S E K+DTAVLQFQN KL QKLE Q+
Sbjct: 1   MASTGEPDRKRRHFSSISPSEAAAAVKKQPFFWPSSEDKLDTAVLQFQNLKLSQKLEAQQ 60

Query: 59  VEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSII 118
           VE S LE+K +Q+KE+Q PY+S+LK V+KSWE+L   +ESCS+R  +SS+G   R ++  
Sbjct: 61  VECSILEDKLSQIKEKQLPYNSSLKTVHKSWEKLTASVESCSVRVSDSSSGAH-RFVNKE 119

Query: 119 EDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLW 178
           +  +P   +D F++RL+ETGATESSS++ C NQMEE+      +    + N++AA ++L 
Sbjct: 120 DGSSPAVKND-FINRLLETGATESSSSNICSNQMEENGVNTSSQMTQTLYNLVAATEDLR 178

Query: 179 HLKGGLYAAVLK-DLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDID 237
            LK  LY  VL+ +L      Q A S L+SE+K+ R  L D+ +K KSL+RELQS +D D
Sbjct: 179 CLKDELYPTVLRTNLGKDLCGQLALSELESEIKSFRGDLDDVLVKFKSLSRELQSHRDAD 238

Query: 238 AKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRD 297
           AK +  L R++GELE  V EL++CN  L+ALRAERD T GAFFPVL+LGNK    DR RD
Sbjct: 239 AKVRVDLKRIRGELEDEVVELQQCNGDLSALRAERDATAGAFFPVLSLGNKLATSDRERD 298

Query: 298 EQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFL 357
           +QRDL+DME+V KEL   AS +L +LK LH+ R K+L ++ NLQN  KSV+C+SSS+A L
Sbjct: 299 KQRDLQDMETVLKELTVLASGRLQQLKNLHEERTKMLGKMSNLQNKSKSVRCISSSQACL 358

Query: 358 SVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIAD 417
           S+K+QLEKSK  VF+Y AL EKLQVEKD++ W+E E+N+K +L DV R++SAVTDS++A 
Sbjct: 359 SLKDQLEKSKEAVFQYMALLEKLQVEKDSIVWKEREINIKNELGDVSRKTSAVTDSRMAS 418

Query: 418 LGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAA 477
           L  EIQKQ+DEK RI+ RL   SRE GRKEI A+ +AL+SSFPE+MS+M+ QL+ YKE A
Sbjct: 419 LDSEIQKQLDEKMRIKTRLGNISRERGRKEIFADMKALISSFPEEMSSMRSQLNNYKETA 478

Query: 478 LDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILD 537
             IH LRADV SL+ VL RK KE E L   SAD  +++  L A V DL +S+ ELKL LD
Sbjct: 479 GGIHSLRADVQSLSGVLCRKTKEYEALQLRSADYASQLGDLNATVCDLKNSHEELKLFLD 538

Query: 538 MYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAE 597
           MY+RESTD+RD+  A++ EY+AWAHV SLKSSLDEQ+LELRVK A EAEA+SQQ LAAAE
Sbjct: 539 MYKRESTDARDIAEAKEQEYRAWAHVQSLKSSLDEQNLELRVKAANEAEAVSQQMLAAAE 598

Query: 598 AEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQIT 657
           AEIAD+RQK++  KRD+   SD LKSK+EE   YLSEI+TIG +Y+D+  QNQQLL Q+T
Sbjct: 599 AEIADLRQKMDDCKRDVAKHSDILKSKHEEHGTYLSEIQTIGSAYEDIVPQNQQLLLQVT 658

Query: 658 ERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLD 717
           ERDDYNIKL LEG+ +RQ+QD LL+DK++M+ +IQQ +A  +F   K++RIE+QLRFC D
Sbjct: 659 ERDDYNIKLFLEGITSRQMQDTLLIDKYIMDKDIQQGSAYASFLSKKSSRIEDQLRFCTD 718

Query: 718 QAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVK 777
           Q Q+LAED+ Q S +LEN QK+ +D+     Q R  LEES SKV +SRL    L++EL  
Sbjct: 719 QFQKLAEDKYQKSVSLENLQKKRADIGNGLEQARSRLEESHSKVEQSRLDYGALELELEI 778

Query: 778 ERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVI 837
           ERF ++R+EE++E+ ++KV RL++  EGSS I++L+QEL E++EILKC  C +RPKEVVI
Sbjct: 779 ERFNRRRIEEEMEIAKKKVSRLRSLIEGSSAIQKLRQELSEFKEILKCKACNDRPKEVVI 838

Query: 838 TKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI 877
           TKCYHLFCNPCVQK+T +R +KCP C+ASF PND+KP+YI
Sbjct: 839 TKCYHLFCNPCVQKLTGTRQKKCPTCSASFGPNDIKPIYI 878




E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6. Required for the regulation of flowering time and defense against necrotrophic fungal pathogens.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q7XU27|BRE1A_ORYSJ E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. japonica GN=BRE1A PE=2 SV=3 Back     alignment and function description
>sp|A2XW69|BRE1A_ORYSI E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. indica GN=BRE1A PE=3 SV=2 Back     alignment and function description
>sp|Q9C895|BRE1B_ARATH E3 ubiquitin-protein ligase BRE1-like 2 OS=Arabidopsis thaliana GN=HUB2 PE=1 SV=2 Back     alignment and function description
>sp|Q336R3|BRE1B_ORYSJ E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. japonica GN=BRE1B PE=2 SV=1 Back     alignment and function description
>sp|A2ZAC2|BRE1B_ORYSI E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. indica GN=BRE1B PE=3 SV=2 Back     alignment and function description
>sp|Q8CJB9|BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus GN=Rnf40 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7K7|BRE1B_MACFA E3 ubiquitin-protein ligase BRE1B OS=Macaca fascicularis GN=RNF40 PE=2 SV=1 Back     alignment and function description
>sp|Q3U319|BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus GN=Rnf40 PE=2 SV=2 Back     alignment and function description
>sp|O75150|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens GN=RNF40 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query877
297734578878 unnamed protein product [Vitis vinifera] 0.998 0.997 0.701 0.0
225453456901 PREDICTED: E3 ubiquitin-protein ligase B 0.998 0.972 0.684 0.0
224067588877 histone ubiquitination proteins group [P 0.990 0.990 0.676 0.0
356539611873 PREDICTED: E3 ubiquitin-protein ligase B 0.992 0.996 0.636 0.0
356498180874 PREDICTED: E3 ubiquitin-protein ligase B 0.993 0.996 0.634 0.0
224136330884 histone ubiquitination proteins group [P 0.915 0.908 0.638 0.0
449431978878 PREDICTED: E3 ubiquitin-protein ligase B 1.0 0.998 0.612 0.0
357504631947 E3 ubiquitin-protein ligase BRE1-like pr 0.998 0.925 0.565 0.0
297828217878 histone mono-ubiquitination 1 [Arabidops 0.997 0.996 0.585 0.0
30689877878 E3 ubiquitin-protein ligase BRE1-like 1 0.997 0.996 0.585 0.0
>gi|297734578|emb|CBI16629.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1225 bits (3170), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/879 (70%), Positives = 734/879 (83%), Gaps = 3/879 (0%)

Query: 1   MGSTGEPDRKRRHFSSISPTAATAKKNPFFPSSEEKKIDTAVLQFQNQKLVQKLETQKVE 60
           MGSTGEPDRKRRHFSS+SPTAATAKK PF P SE+KK+DTAVLQ+QNQKL QKLE QKVE
Sbjct: 1   MGSTGEPDRKRRHFSSLSPTAATAKKMPFLPVSEDKKLDTAVLQYQNQKLKQKLEAQKVE 60

Query: 61  YSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRARES-SNGQESRCLSIIE 119
            SALENKF+QLKE QQ Y++TL +VNK+W EL+ +LE+CS+  ++S S G+  +  S  E
Sbjct: 61  CSALENKFSQLKETQQSYNTTLTLVNKTWRELVDNLETCSVHLKDSASAGRHVKLPSTTE 120

Query: 120 DVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWH 179
           D       DAFLSRL+ETGATES SA++  ++MEEDR T   +TKN +SNI++ +++LW 
Sbjct: 121 DGNS-CLQDAFLSRLIETGATESCSANDFSDRMEEDRPTSCGKTKNSLSNIVSTINDLWC 179

Query: 180 LKGGLYAAVLKDL-QDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDA 238
           LK GLYAAVL+ L +DG   +K SS+L +EV N+RLA  DLHLKHKS+TR++QS +DIDA
Sbjct: 180 LKDGLYAAVLEALPEDGLCNKKISSDLHAEVNNMRLAFGDLHLKHKSVTRDMQSHRDIDA 239

Query: 239 KDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDE 298
           K+KA+L RL+GELES V ELEE NCKL  L+AERD  KGAFFP+L+LG+K+VAGD+ RD+
Sbjct: 240 KNKAELKRLRGELESTVAELEESNCKLVTLKAERDAAKGAFFPILSLGSKNVAGDKARDK 299

Query: 299 QRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLS 358
           Q+DL DME+  KEL+DQ+S +LLELK L++ RI +L+QL NLQNTLK+VKC+SSS A++ 
Sbjct: 300 QKDLHDMEATLKELLDQSSSRLLELKALYEERIGILKQLSNLQNTLKNVKCISSSSAYVL 359

Query: 359 VKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADL 418
           V +QLEKSK+EV  YQALFEKLQVEKDNL WRE E+NMK D VDVFRRSS VTDS++++L
Sbjct: 360 VTDQLEKSKAEVVHYQALFEKLQVEKDNLVWREKEVNMKNDFVDVFRRSSVVTDSRLSEL 419

Query: 419 GIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAAL 478
            IEIQ QI+E+N IE++LEEASREPGRKEIIAEF+AL+SSFP++M  MQ QL KYKEAA 
Sbjct: 420 RIEIQNQINERNLIEIKLEEASREPGRKEIIAEFKALLSSFPDNMGTMQNQLRKYKEAAS 479

Query: 479 DIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDM 538
           D+H LRADV SL++VLERK KE ETL   SADQVA+I KLQA++QDL +S+++LKLIL+M
Sbjct: 480 DVHSLRADVQSLSSVLERKEKELETLSTRSADQVADIRKLQALIQDLEESDIQLKLILEM 539

Query: 539 YRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEA 598
           YR ES DSRDVL ARD EYKAWAHV SLKSSL+E SLELRVKTAIEAEA+SQQRLAAAEA
Sbjct: 540 YRCESVDSRDVLEARDKEYKAWAHVQSLKSSLNEHSLELRVKTAIEAEALSQQRLAAAEA 599

Query: 599 EIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITE 658
            I D+RQKLEA KRDM  LSD LKSK+EE EAYLSEIETIGQ+YDDMQTQNQ LLQQITE
Sbjct: 600 VIVDLRQKLEASKRDMFRLSDVLKSKHEENEAYLSEIETIGQAYDDMQTQNQHLLQQITE 659

Query: 659 RDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQ 718
           RDDYNIKLVLEGVR+RQLQD+LLM+K  ME   Q+A  SL FFDMKA RIE+QL+ C DQ
Sbjct: 660 RDDYNIKLVLEGVRSRQLQDSLLMEKQTMERGFQRATTSLGFFDMKAGRIEDQLKMCSDQ 719

Query: 719 AQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKE 778
            Q+LAEDR Q+   L N QKRL DV + S Q R SLEESQSKV KSR++L ELQIEL KE
Sbjct: 720 VQKLAEDRLQSLGTLANFQKRLLDVTRLSQQARESLEESQSKVDKSRVSLGELQIELEKE 779

Query: 779 RFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVIT 838
           RF KKR EE+LE+ RRK  RL+AQTEGSSI+++L+QELREYR+ILKC IC ERPKEVVIT
Sbjct: 780 RFEKKRTEEELEVVRRKASRLRAQTEGSSIVDKLRQELREYRDILKCGICHERPKEVVIT 839

Query: 839 KCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI 877
           KCYHLFCNPCVQ++ E+R+RKCP C+ASF PNDVKPVYI
Sbjct: 840 KCYHLFCNPCVQRIIEARNRKCPVCSASFGPNDVKPVYI 878




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225453456|ref|XP_002274055.1| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224067588|ref|XP_002302510.1| histone ubiquitination proteins group [Populus trichocarpa] gi|222844236|gb|EEE81783.1| histone ubiquitination proteins group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356539611|ref|XP_003538290.1| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356498180|ref|XP_003517931.1| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Glycine max] Back     alignment and taxonomy information
>gi|224136330|ref|XP_002326834.1| histone ubiquitination proteins group [Populus trichocarpa] gi|222835149|gb|EEE73584.1| histone ubiquitination proteins group [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449431978|ref|XP_004133777.1| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Cucumis sativus] gi|449478010|ref|XP_004155194.1| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357504631|ref|XP_003622604.1| E3 ubiquitin-protein ligase BRE1-like protein [Medicago truncatula] gi|355497619|gb|AES78822.1| E3 ubiquitin-protein ligase BRE1-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297828217|ref|XP_002881991.1| histone mono-ubiquitination 1 [Arabidopsis lyrata subsp. lyrata] gi|297327830|gb|EFH58250.1| histone mono-ubiquitination 1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30689877|ref|NP_182022.2| E3 ubiquitin-protein ligase BRE1-like 1 [Arabidopsis thaliana] gi|75303266|sp|Q8RXD6.1|BRE1A_ARATH RecName: Full=E3 ubiquitin-protein ligase BRE1-like 1; Short=AtBRE1; AltName: Full=Protein HISTONE MONOUBIQUITINATION 1; Short=AtHUB1 gi|19698951|gb|AAL91211.1| unknown protein [Arabidopsis thaliana] gi|34098841|gb|AAQ56803.1| At2g44950 [Arabidopsis thaliana] gi|330255395|gb|AEC10489.1| E3 ubiquitin-protein ligase BRE1-like 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query877
TAIR|locus:2054997878 HUB1 "histone mono-ubiquitinat 0.996 0.995 0.568 3.9e-250
TAIR|locus:2035726900 HUB2 "histone mono-ubiquitinat 0.948 0.924 0.326 1.1e-117
UNIPROTKB|H3BP71961 RNF40 "E3 ubiquitin-protein li 0.424 0.387 0.269 4.2e-40
UNIPROTKB|Q4R7K71001 RNF40 "E3 ubiquitin-protein li 0.424 0.371 0.269 5.2e-40
UNIPROTKB|O751501001 RNF40 "E3 ubiquitin-protein li 0.424 0.371 0.269 5.3e-40
MGI|MGI:21420481001 Rnf40 "ring finger protein 40" 0.399 0.349 0.280 5.5e-40
UNIPROTKB|Q5RAU71001 RNF40 "E3 ubiquitin-protein li 0.424 0.371 0.269 8.6e-40
RGD|6286381002 Rnf40 "ring finger protein 40, 0.397 0.348 0.282 1e-38
FB|FBgn00866941044 Bre1 "Bre1" [Drosophila melano 0.410 0.344 0.25 4.6e-38
UNIPROTKB|E2R1L51001 RNF40 "Uncharacterized protein 0.425 0.372 0.273 5.1e-38
TAIR|locus:2054997 HUB1 "histone mono-ubiquitination 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2409 (853.1 bits), Expect = 3.9e-250, P = 3.9e-250
 Identities = 501/881 (56%), Positives = 647/881 (73%)

Query:     1 MGSTGEPDRKRRHFSSISPT--AATAKKNPFF-PSSEEKKIDTAVLQFQNQKLVQKLETQ 57
             M STGEPDRKRRHFSSISP+  AA  KK PFF PSSE+K +DTAVLQFQN KL QKLE Q
Sbjct:     1 MASTGEPDRKRRHFSSISPSEAAAAVKKQPFFWPSSEDK-LDTAVLQFQNLKLSQKLEAQ 59

Query:    58 KVEYSALENKFAQLKERQQPYDSTLKVVNKSWEELITDLESCSMRARESSNGQESRCLSI 117
             +VE S LE+K +Q+KE+Q PY+S+LK V+KSWE+L   +ESCS+R  +SS+G   R ++ 
Sbjct:    60 QVECSILEDKLSQIKEKQLPYNSSLKTVHKSWEKLTASVESCSVRVSDSSSGAH-RFVNK 118

Query:   118 IEDVTPHPSHDAFLSRLMETGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNL 177
              +  +P   +D F++RL+ETGATESSS++ C NQMEE+      +    + N++AA ++L
Sbjct:   119 EDGSSPAVKND-FINRLLETGATESSSSNICSNQMEENGVNTSSQMTQTLYNLVAATEDL 177

Query:   178 WHLKGGLYAAVLK-DLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDI 236
               LK  LY  VL+ +L      Q A S L+SE+K+ R  L D+ +K KSL+RELQS +D 
Sbjct:   178 RCLKDELYPTVLRTNLGKDLCGQLALSELESEIKSFRGDLDDVLVKFKSLSRELQSHRDA 237

Query:   237 DAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVR 296
             DAK +  L R++GELE  V EL++CN  L+ALRAERD T GAFFPVL+LGNK    DR R
Sbjct:   238 DAKVRVDLKRIRGELEDEVVELQQCNGDLSALRAERDATAGAFFPVLSLGNKLATSDRER 297

Query:   297 DEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAF 356
             D+QRDL+DME+V KEL   AS +L +LK LH+ R K+L ++ NLQN  KSV+C+SSS+A 
Sbjct:   298 DKQRDLQDMETVLKELTVLASGRLQQLKNLHEERTKMLGKMSNLQNKSKSVRCISSSQAC 357

Query:   357 LSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIA 416
             LS+K+QLEKSK  VF+Y AL EKLQVEKD++ W+E E+N+K +L DV R++SAVTDS++A
Sbjct:   358 LSLKDQLEKSKEAVFQYMALLEKLQVEKDSIVWKEREINIKNELGDVSRKTSAVTDSRMA 417

Query:   417 DLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEA 476
              L  EIQKQ+DEK RI+ RL   SRE GRKEI A+ +AL+SSFPE+MS+M+ QL+ YKE 
Sbjct:   418 SLDSEIQKQLDEKMRIKTRLGNISRERGRKEIFADMKALISSFPEEMSSMRSQLNNYKET 477

Query:   477 ALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLIL 536
             A  IH LRADV SL+ VL RK KE E L   SAD  +++  L A V DL +S+ ELKL L
Sbjct:   478 AGGIHSLRADVQSLSGVLCRKTKEYEALQLRSADYASQLGDLNATVCDLKNSHEELKLFL 537

Query:   537 DMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAA 596
             DMY+RESTD+RD+  A++ EY+AWAHV SLKSSLDEQ+LELRVK A EAEA+SQQ LAAA
Sbjct:   538 DMYKRESTDARDIAEAKEQEYRAWAHVQSLKSSLDEQNLELRVKAANEAEAVSQQMLAAA 597

Query:   597 EAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMXXXXXXXXXXI 656
             EAEIAD+RQK++  KRD+   SD LKSK+EE   YLSEI+TIG +Y+D+          +
Sbjct:   598 EAEIADLRQKMDDCKRDVAKHSDILKSKHEEHGTYLSEIQTIGSAYEDIVPQNQQLLLQV 657

Query:   657 TERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCL 716
             TERDDYNIKL LEG+ +RQ+QD LL+DK++M+ +IQQ +A  +F   K++RIE+QLRFC 
Sbjct:   658 TERDDYNIKLFLEGITSRQMQDTLLIDKYIMDKDIQQGSAYASFLSKKSSRIEDQLRFCT 717

Query:   717 DQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELV 776
             DQ Q+LAED+ Q S +LEN QK+ +D+     Q R  LEES SKV +SRL    L++EL 
Sbjct:   718 DQFQKLAEDKYQKSVSLENLQKKRADIGNGLEQARSRLEESHSKVEQSRLDYGALELELE 777

Query:   777 KERFAKKRLEEDLEMGRRKVLRLQAQTEGSSXXXXXXXXXXXXXXXXKCSICLERPKEVV 836
              ERF ++R+EE++E+ ++KV RL++  EGSS                KC  C +RPKEVV
Sbjct:   778 IERFNRRRIEEEMEIAKKKVSRLRSLIEGSSAIQKLRQELSEFKEILKCKACNDRPKEVV 837

Query:   837 ITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI 877
             ITKCYHLFCNPCVQK+T +R +KCP C+ASF PND+KP+YI
Sbjct:   838 ITKCYHLFCNPCVQKLTGTRQKKCPTCSASFGPNDIKPIYI 878




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0010162 "seed dormancy process" evidence=RCA;IMP
GO:0005739 "mitochondrion" evidence=IDA
GO:0010390 "histone monoubiquitination" evidence=IMP
GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA
GO:0006513 "protein monoubiquitination" evidence=IDA
GO:0009965 "leaf morphogenesis" evidence=IMP
GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=IMP
GO:0016049 "cell growth" evidence=RCA;IMP
GO:0048505 "regulation of timing of cell differentiation" evidence=IMP
GO:0051301 "cell division" evidence=RCA;IMP
GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA;IMP
GO:0033523 "histone H2B ubiquitination" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IPI
GO:0005515 "protein binding" evidence=IPI
GO:0009817 "defense response to fungus, incompatible interaction" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA
GO:0003002 "regionalization" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0006406 "mRNA export from nucleus" evidence=RCA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007155 "cell adhesion" evidence=RCA
GO:0007346 "regulation of mitotic cell cycle" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009793 "embryo development ending in seed dormancy" evidence=RCA
GO:0009845 "seed germination" evidence=RCA
GO:0009880 "embryonic pattern specification" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0009933 "meristem structural organization" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010072 "primary shoot apical meristem specification" evidence=RCA
GO:0010074 "maintenance of meristem identity" evidence=RCA
GO:0010090 "trichome morphogenesis" evidence=RCA
GO:0010182 "sugar mediated signaling pathway" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0010431 "seed maturation" evidence=RCA
GO:0010564 "regulation of cell cycle process" evidence=RCA
GO:0016567 "protein ubiquitination" evidence=RCA
GO:0016571 "histone methylation" evidence=RCA
GO:0016579 "protein deubiquitination" evidence=RCA
GO:0016926 "protein desumoylation" evidence=RCA
GO:0019915 "lipid storage" evidence=RCA
GO:0033043 "regulation of organelle organization" evidence=RCA
GO:0045010 "actin nucleation" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
GO:0045595 "regulation of cell differentiation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0048366 "leaf development" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048589 "developmental growth" evidence=RCA
GO:0048825 "cotyledon development" evidence=RCA
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA
GO:0050826 "response to freezing" evidence=RCA
TAIR|locus:2035726 HUB2 "histone mono-ubiquitination 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H3BP71 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7K7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|O75150 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2142048 Rnf40 "ring finger protein 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RAU7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|628638 Rnf40 "ring finger protein 40, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0086694 Bre1 "Bre1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2R1L5 RNF40 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RXD6BRE1A_ARATH6, ., 3, ., 2, ., -0.58520.99770.9965yesno
Q336R3BRE1B_ORYSJ6, ., 3, ., 2, ., -0.33790.93150.9680yesno
Q7XU27BRE1A_ORYSJ6, ., 3, ., 2, ., -0.47620.99770.9898yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00019139001
SubName- Full=Chromosome chr15 scaffold_19, whole genome shotgun sequence; (878 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query877
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-12
smart0018440 smart00184, RING, Ring finger 3e-12
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-11
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-11
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-10
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-08
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 6e-08
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-07
PLN03208 193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 1e-06
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-06
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 3e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 7e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 8e-06
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 4e-04
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA 8e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
TIGR021681179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
TIGR021691164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.004
TIGR04211198 TIGR04211, SH3_and_anchor, SH3 domain protein 0.004
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
 Score = 62.5 bits (152), Expect = 1e-12
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 825 CSICLERPKE-VVITKCYHLFCNPCVQKVTESRHRKCPGC 863
           C ICLE PK+ V I  C HLFC+ C+    ES +  CP C
Sbjct: 1   CPICLEEPKDPVTILPCGHLFCSKCILSWLESGNVTCPLC 40


The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid. Many proteins containing a RING finger play a key role in the ubiquitination pathway. Length = 40

>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 877
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 100.0
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 99.92
KOG01611930 consensus Myosin class II heavy chain [Cytoskeleto 99.92
KOG0161 1930 consensus Myosin class II heavy chain [Cytoskeleto 99.84
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 99.82
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 99.82
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.81
TIGR006061311 rad50 rad50. This family is based on the phylogeno 99.79
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.78
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 99.78
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.76
COG11961163 Smc Chromosome segregation ATPases [Cell division 99.75
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.74
KOG4674 1822 consensus Uncharacterized conserved coiled-coil pr 99.69
PF10174775 Cast: RIM-binding protein of the cytomatrix active 99.68
PRK02224880 chromosome segregation protein; Provisional 99.67
PRK02224880 chromosome segregation protein; Provisional 99.67
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 99.66
KOG0933 1174 consensus Structural maintenance of chromosome pro 99.64
KOG0996 1293 consensus Structural maintenance of chromosome pro 99.6
PRK03918880 chromosome segregation protein; Provisional 99.59
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 99.58
KOG0996 1293 consensus Structural maintenance of chromosome pro 99.56
PRK03918880 chromosome segregation protein; Provisional 99.55
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.42
KOG0962 1294 consensus DNA repair protein RAD50, ABC-type ATPas 99.32
PRK01156 895 chromosome segregation protein; Provisional 99.3
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.3
KOG0964 1200 consensus Structural maintenance of chromosome pro 99.27
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.22
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.2
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.19
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.18
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 99.17
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 99.16
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 99.13
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.12
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 99.12
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 99.09
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.06
KOG0933 1174 consensus Structural maintenance of chromosome pro 99.06
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 99.05
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 99.02
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.01
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.98
PRK04863 1486 mukB cell division protein MukB; Provisional 98.95
PHA02926242 zinc finger-like protein; Provisional 98.92
KOG0964 1200 consensus Structural maintenance of chromosome pro 98.91
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.89
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.89
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.89
PF1463444 zf-RING_5: zinc-RING finger domain 98.88
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.88
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 98.87
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.87
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.84
PRK04778569 septation ring formation regulator EzrA; Provision 98.84
PHA02929238 N1R/p28-like protein; Provisional 98.83
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.83
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.82
PRK04778569 septation ring formation regulator EzrA; Provision 98.8
KOG02501074 consensus DNA repair protein RAD18 (SMC family pro 98.79
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 98.78
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 98.77
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.73
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 98.7
KOG0976 1265 consensus Rho/Rac1-interacting serine/threonine ki 98.69
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.69
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.69
KOG0971 1243 consensus Microtubule-associated protein dynactin 98.68
PF07888546 CALCOCO1: Calcium binding and coiled-coil domain ( 98.66
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 98.64
KOG09941758 consensus Extracellular matrix glycoprotein Lamini 98.63
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 98.57
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 98.56
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 98.55
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.55
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 98.48
COG5152259 Uncharacterized conserved protein, contains RING a 98.45
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.42
PF00038312 Filament: Intermediate filament protein; InterPro: 98.38
PF00038312 Filament: Intermediate filament protein; InterPro: 98.36
KOG0977546 consensus Nuclear envelope protein lamin, intermed 98.35
PF05483786 SCP-1: Synaptonemal complex protein 1 (SCP-1); Int 98.35
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.25
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 98.24
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 98.19
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.17
KOG09621294 consensus DNA repair protein RAD50, ABC-type ATPas 98.16
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.16
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 98.15
PRK11637428 AmiB activator; Provisional 98.1
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 98.08
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.06
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.06
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 98.04
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 98.04
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 98.03
KOG0018 1141 consensus Structural maintenance of chromosome pro 98.03
PF14662193 CCDC155: Coiled-coil region of CCDC155 98.02
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 98.0
KOG4673961 consensus Transcription factor TMF, TATA element m 97.97
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 97.92
PHA02562562 46 endonuclease subunit; Provisional 97.92
PRK04863 1486 mukB cell division protein MukB; Provisional 97.91
PHA02562562 46 endonuclease subunit; Provisional 97.91
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.91
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.85
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
PF04641260 Rtf2: Rtf2 RING-finger 97.84
COG5222427 Uncharacterized conserved protein, contains RING Z 97.84
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 97.81
KOG2660 331 consensus Locus-specific chromosome binding protei 97.81
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.77
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 97.74
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 97.73
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.73
KOG1003205 consensus Actin filament-coating protein tropomyos 97.71
PF14662193 CCDC155: Coiled-coil region of CCDC155 97.69
KOG0018 1141 consensus Structural maintenance of chromosome pro 97.68
KOG3039303 consensus Uncharacterized conserved protein [Funct 97.67
KOG4673961 consensus Transcription factor TMF, TATA element m 97.65
KOG1002 791 consensus Nucleotide excision repair protein RAD16 97.64
COG1340294 Uncharacterized archaeal coiled-coil protein [Func 97.64
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 97.59
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 97.55
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.55
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 97.55
COG4372 499 Uncharacterized protein conserved in bacteria with 97.54
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 97.53
PF05622713 HOOK: HOOK protein; InterPro: IPR008636 This famil 97.49
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 97.47
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.46
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 97.42
COG4942420 Membrane-bound metallopeptidase [Cell division and 97.42
KOG0995581 consensus Centromere-associated protein HEC1 [Cell 97.4
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 97.39
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 97.39
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.32
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 97.32
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.29
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 97.27
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.21
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 97.2
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.13
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 97.13
PF15070617 GOLGA2L5: Putative golgin subfamily A member 2-lik 97.1
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 97.09
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 97.05
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.93
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.89
KOG4593716 consensus Mitotic checkpoint protein MAD1 [Cell cy 96.85
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 96.83
KOG0963 629 consensus Transcription factor/CCAAT displacement 96.8
COG5109396 Uncharacterized conserved protein, contains RING Z 96.78
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.74
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 96.65
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 96.58
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 96.57
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 96.56
COG0419908 SbcC ATPase involved in DNA repair [DNA replicatio 96.53
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 96.52
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 96.52
COG3883265 Uncharacterized protein conserved in bacteria [Fun 96.47
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 96.43
KOG0980 980 consensus Actin-binding protein SLA2/Huntingtin-in 96.41
COG5175 480 MOT2 Transcriptional repressor [Transcription] 96.4
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 96.32
PF13514 1111 AAA_27: AAA domain 96.31
KOG149384 consensus Anaphase-promoting complex (APC), subuni 96.3
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 96.24
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.19
KOG1941518 consensus Acetylcholine receptor-associated protei 96.17
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 96.16
COG3883265 Uncharacterized protein conserved in bacteria [Fun 96.13
KOG0979 1072 consensus Structural maintenance of chromosome pro 96.09
KOG3002 299 consensus Zn finger protein [General function pred 96.05
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.03
KOG0963629 consensus Transcription factor/CCAAT displacement 95.93
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 95.86
PF09730717 BicD: Microtubule-associated protein Bicaudal-D; I 95.83
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 95.79
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 95.72
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.72
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 95.62
COG52191525 Uncharacterized conserved protein, contains RING Z 95.58
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 95.57
KOG3113 293 consensus Uncharacterized conserved protein [Funct 95.38
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 95.34
PF13514 1111 AAA_27: AAA domain 95.24
KOG0298 1394 consensus DEAD box-containing helicase-like transc 95.17
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 95.06
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 95.04
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.98
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 94.97
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 94.95
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.94
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.9
KOG4360596 consensus Uncharacterized coiled coil protein [Fun 94.9
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 94.87
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.84
KOG4445 368 consensus Uncharacterized conserved protein, conta 94.81
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.71
PRK11281 1113 hypothetical protein; Provisional 94.69
PHA03096284 p28-like protein; Provisional 94.64
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 94.59
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 94.43
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 94.4
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 94.38
KOG0971 1243 consensus Microtubule-associated protein dynactin 94.22
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 94.21
KOG1937521 consensus Uncharacterized conserved protein [Funct 94.16
PRK11281 1113 hypothetical protein; Provisional 94.14
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 94.12
TIGR01005 754 eps_transp_fam exopolysaccharide transport protein 94.02
PF05010207 TACC: Transforming acidic coiled-coil-containing p 93.59
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 93.42
COG4477570 EzrA Negative regulator of septation ring formatio 93.42
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.31
KOG3039 303 consensus Uncharacterized conserved protein [Funct 93.27
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 93.2
COG381384 Uncharacterized protein conserved in bacteria [Fun 93.19
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 93.15
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.0
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 92.91
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 92.88
COG5185622 HEC1 Protein involved in chromosome segregation, i 92.63
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 92.59
TIGR01843423 type_I_hlyD type I secretion membrane fusion prote 92.57
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 92.53
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 92.48
PRK10929 1109 putative mechanosensitive channel protein; Provisi 92.45
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.85
PF13870177 DUF4201: Domain of unknown function (DUF4201) 91.84
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 91.71
TIGR03185650 DNA_S_dndD DNA sulfur modification protein DndD. T 91.65
KOG09791072 consensus Structural maintenance of chromosome pro 91.65
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 91.64
COG4026290 Uncharacterized protein containing TOPRIM domain, 91.38
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 91.28
PF13870177 DUF4201: Domain of unknown function (DUF4201) 90.72
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 90.68
PF05911769 DUF869: Plant protein of unknown function (DUF869) 90.64
COG5185622 HEC1 Protein involved in chromosome segregation, i 90.6
COG4477570 EzrA Negative regulator of septation ring formatio 90.55
TIGR01562305 FdhE formate dehydrogenase accessory protein FdhE. 90.53
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 90.48
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 90.44
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 90.39
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 90.36
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 90.21
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 89.87
PF07111739 HCR: Alpha helical coiled-coil rod protein (HCR); 89.86
PF1023590 Cript: Microtubule-associated protein CRIPT; Inter 89.66
KOG0249 916 consensus LAR-interacting protein and related prot 89.53
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 89.03
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 88.9
KOG0825 1134 consensus PHD Zn-finger protein [General function 88.76
PF06785401 UPF0242: Uncharacterised protein family (UPF0242); 88.72
KOG2462279 consensus C2H2-type Zn-finger protein [Transcripti 88.63
PRK03564309 formate dehydrogenase accessory protein FdhE; Prov 88.57
PF05384159 DegS: Sensor protein DegS; InterPro: IPR008595 Thi 88.56
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 88.52
PF15066527 CAGE1: Cancer-associated gene protein 1 family 88.49
KOG0999772 consensus Microtubule-associated protein Bicaudal- 88.36
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 88.34
KOG3899381 consensus Uncharacterized conserved protein [Funct 88.19
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 88.01
KOG0972384 consensus Huntingtin interacting protein 1 (Hip1) 87.94
COG4647165 AcxC Acetone carboxylase, gamma subunit [Secondary 87.77
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 87.71
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 87.66
KOG1940276 consensus Zn-finger protein [General function pred 87.34
cd0006557 FYVE FYVE domain; Zinc-binding domain; targets pro 87.15
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 87.13
KOG2991330 consensus Splicing regulator [RNA processing and m 87.02
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 87.01
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 86.76
PF13851201 GAS: Growth-arrest specific micro-tubule binding 86.58
KOG2068327 consensus MOT2 transcription factor [Transcription 86.32
PRK04023 1121 DNA polymerase II large subunit; Validated 86.25
KOG4718235 consensus Non-SMC (structural maintenance of chrom 85.91
PF1324023 zinc_ribbon_2: zinc-ribbon domain 85.85
KOG2991330 consensus Splicing regulator [RNA processing and m 85.67
PF02318118 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 85.66
KOG1899 861 consensus LAR transmembrane tyrosine phosphatase-i 85.64
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 85.54
PF0136369 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f 85.42
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 85.3
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 85.17
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 85.14
PF15616131 TerY-C: TerY-C metal binding domain 84.82
COG4026290 Uncharacterized protein containing TOPRIM domain, 84.57
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 84.21
KOG2979262 consensus Protein involved in DNA repair [General 84.15
KOG0993542 consensus Rab5 GTPase effector Rabaptin-5 [Intrace 83.72
PF10267395 Tmemb_cc2: Predicted transmembrane and coiled-coil 83.63
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 83.59
PF1266099 zf-TFIIIC: Putative zinc-finger of transcription f 83.45
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 83.14
KOG1729288 consensus FYVE finger containing protein [General 82.59
PRK10884206 SH3 domain-containing protein; Provisional 82.21
PF1324826 zf-ribbon_3: zinc-ribbon domain 82.17
KOG3799169 consensus Rab3 effector RIM1 and related proteins, 81.86
PF14353128 CpXC: CpXC protein 81.4
KOG0249 916 consensus LAR-interacting protein and related prot 81.34
KOG4302 660 consensus Microtubule-associated protein essential 80.93
PF08882112 Acetone_carb_G: Acetone carboxylase gamma subunit; 80.7
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 80.52
KOG1937521 consensus Uncharacterized conserved protein [Funct 80.51
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=2.6e-38  Score=335.15  Aligned_cols=686  Identities=29%  Similarity=0.403  Sum_probs=482.6

Q ss_pred             hHhhchhHHHHHHHHHHHHHHHHHHhhhhhHHHHhccccCCchhhhhhhhhHHHHHHHHHHHHHHHHHhHHHHHHHHHHH
Q 002815          155 DRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQ  234 (877)
Q Consensus       155 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~e~~~l~~~l~~~~~~~~~~~~~~~~~~  234 (877)
                      .+..++......+......++.+....+.+...+...   -..+......+..+...++...+.+..++..+...+..+.
T Consensus         6 ~~~~~i~~~~~~~~~~~~~~D~lq~~~e~~~~~~~~~---~e~l~~~~~~L~~e~e~Lq~~~~~~~~~~~~~~~~~~el~   82 (698)
T KOG0978|consen    6 PLAGRIKSEKEAVSLVLIQIDDLQTQAEELARRLNRV---EEALTVLFDELAEENEKLQNLADHLQEKHATLSEQISELL   82 (698)
T ss_pred             hhHHHHHhhhhhhcccchhhHHHHHHHHHHHhhhhHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444455555555556666666666555554433321   0011225667788888999999999999999999999999


Q ss_pred             hhhHhhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHhhhhhcCCCcccccccCcccCCccchhhhhhHHHHHHHHHHHHH
Q 002815          235 DIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMD  314 (877)
Q Consensus       235 ~~~~~~~~e~~~l~~~l~~l~~ele~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~  314 (877)
                      +.+.....+...+...++.+..+++.+......+............. ...++ +..++..+-....+..+...+++++.
T Consensus        83 ~k~s~~~~~~~e~~~~le~~~~d~eki~~~~~~l~~~la~~~~~~~t-~~~~~-~~~~~~~t~~~t~~~~l~~~iee~~~  160 (698)
T KOG0978|consen   83 DKISTAETEVDELEQQLEDLQADLEKIRRRSNKLNKHLAEALEHLNT-YGNGN-GSLSGTITVNSTELEELRDEIEELRE  160 (698)
T ss_pred             HHHHHHhccHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhccCCC-CCCcc-cccCcccccchhhhhhhccchhHHHH
Confidence            99999999999999999999999999988877776665554443222 11111 12222233333447777788888887


Q ss_pred             HHHHHHHHHHhHhHhHHHHHHHHHHHHHhhhhhhhhcchhhHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 002815          315 QASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETEL  394 (877)
Q Consensus       315 ~~~~~~~el~~l~~~~~~l~~e~~~l~~~l~~~~~~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~l~~~~~~l~~~~~~~  394 (877)
                      .......+++.++..+..+..++..+...+..+..            ........+..+.     .+..+   ...  ..
T Consensus       161 ~~~~~~~ele~lq~~~~~~~~~~~~~~~~l~~~~~------------~~~~~~~e~~~~~-----~NE~l---~~~--~~  218 (698)
T KOG0978|consen  161 LASTRMEELEKLQLYSDEILRQLDRFRVELRSLKE------------KVRSETFELRCLQ-----YNEEL---QRK--TM  218 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhH------------HHHHHHHHHHHHH-----hhhhc---ccc--cc
Confidence            77788888888888888888887777776532210            0000000000000     00000   000  00


Q ss_pred             hhhhcHHHHHhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHhccCC-chhHHHHHHHHHhcchHHHHHHHHHHHHh
Q 002815          395 NMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPG-RKEIIAEFRALVSSFPEDMSAMQRQLSKY  473 (877)
Q Consensus       395 ~~~~~~~~~~~~~~~~~~~~~~~le~~l~~~~~~~~~l~~~l~~~~~~~~-~~~~~~el~~~~~~l~~~~~~l~~~~~~~  473 (877)
                          ...+..      ....+..++..+.....+++++....+......+ +..+..++..+...+......+......+
T Consensus       219 ----~~~e~~------~~~~~~~lee~~~~~~~e~~~l~~~~e~~~~~~~~~~~in~e~~~L~Ssl~e~~~~l~~~~~~~  288 (698)
T KOG0978|consen  219 ----ESDEAI------NSKKVIKLEEKLAQCVKEYEMLRKEFENNKSQNDLFSSINREMRHLISSLQEHEKLLKEYEREL  288 (698)
T ss_pred             ----hhhhhh------ccchHHHHHHHHHHHHHHHHHHHHhHHHhHHhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                000011      1122456666777777777777766665444443 45788888888888888888887766667


Q ss_pred             HHHHHHHHHHHHhHHhHHHHHHhhHHHHHHHHhhcHHHHHHHHHHHH-HHHHhHhhHHHHHHHHHHHhccCCChhhHHHH
Q 002815          474 KEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQA-MVQDLTDSNLELKLILDMYRRESTDSRDVLAA  552 (877)
Q Consensus       474 ~~~~~~l~~l~~~~~~~~~~l~~~~~~~~~l~~~i~~~~~ei~~l~~-~~~~l~~~~~~l~~~~~~~~~~~~~~~~~~~l  552 (877)
                      ......+..+++...+....+.........+...++........+.. -+..+......++.............+++...
T Consensus       289 k~t~~~~~~lr~~~~s~~~~~~~~~~~~e~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~k~~di~~~  368 (698)
T KOG0978|consen  289 KDTESDNLKLRKQHSSAADSLESKSRDLESLLDKIQDLISQEAELSKKLRSKLLESAKKLKILLREKDRESQKERDILVA  368 (698)
T ss_pred             hcccchHHHHHHHHHHHHhhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhhhHhHHHH
Confidence            77777777777666665555544333344455555555555444442 22222222333333333333333343344444


Q ss_pred             HHHHHH-HHHHHHHHHhhhhHhhHHHHHHHhhHHHHHHHHHHHHHHHHHHHHH-HHHHHHHH---HHHHHHHHHHhhHHH
Q 002815          553 RDLEYK-AWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMR-QKLEAFKR---DMVSLSDALKSKNEE  627 (877)
Q Consensus       553 ~~~~~~-~~~~~~~l~~~l~~~~~e~~~~~~~~~~~~~~~~l~~~~~~l~~l~-~~~~~~~~---~~~~l~~~l~~~~~~  627 (877)
                      ..+... ++..++.+...+.....+.++....+...-.+....-...+...+. ...+....   +...+...+......
T Consensus       369 k~el~~~~~~~le~~k~~~ke~~~~~~~ka~~E~e~l~q~l~~~~k~e~~e~~k~~~d~~~r~~~~~~~~~e~Lqk~~~~  448 (698)
T KOG0978|consen  369 KSELLKTNELRLEMLKSLLKEQRDKLQVKARAETESLLQRLKALDKEERSEIRKQALDDAERQIRQVEELSEELQKKEKN  448 (698)
T ss_pred             HHHHHHHHHHHHHHHhCCCHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHhHHHHHHHHHHHHHHHHH
Confidence            433333 4445555554444333332222222222222333333333444444 23344444   334444455555555


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHhHHHH
Q 002815          628 IEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAAR  707 (877)
Q Consensus       628 ~~~l~~e~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~e~~~l~~~~~~~~~~l~~~~~~~~~  707 (877)
                      ...+..++..+..++++++.++..+..++.+.++..-.++.+...+.+.++.+..++..+...+.++......+...+..
T Consensus       449 ~k~ll~e~~t~gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~~~~~~~~~~i~~  528 (698)
T KOG0978|consen  449 FKCLLSEMETIGSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLKASVDKLELKIGK  528 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56888999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 002815          708 IENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEE  787 (877)
Q Consensus       708 l~~~~~~~~~~~~~l~~el~~~~~~~~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~l~~~l~~~~~~l~~~~~~~~~~~~  787 (877)
                      ++++...+......+..++..+...++.+.....++...+..++..++.....+..+...+.+...+++.+.....++++
T Consensus       529 leeq~~~lt~~~~~l~~el~~~~~~le~~kk~~~e~~~~~~~Lq~~~ek~~~~le~i~~~~~e~~~ele~~~~k~~rleE  608 (698)
T KOG0978|consen  529 LEEQERGLTSNESKLIKELTTLTQSLEMLKKKAQEAKQSLEDLQIELEKSEAKLEQIQEQYAELELELEIEKFKRKRLEE  608 (698)
T ss_pred             HHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhhhhcCcchHHHHHHHHHhccCcccccccccccccccccccchhhhHHhHHHHhccCCCCCCCCCCCC
Q 002815          788 DLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASF  867 (877)
Q Consensus       788 el~~l~~~l~~l~~~~~~~~~~~~l~~~~~~l~~~l~C~~C~~~~~~~~~~~c~h~~c~~C~~~~~~~~~~~Cp~c~~~~  867 (877)
                      ++..++.++..++....++..+..|.+++..|+..++||+|+.+|++.|+++|||+||..|+.+++.+|+|+||.|+.+|
T Consensus       609 E~e~L~~kle~~k~~~~~~s~d~~L~EElk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP~Cn~aF  688 (698)
T KOG0978|consen  609 ELERLKRKLERLKKEESGASADEVLAEELKEYKELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCPKCNAAF  688 (698)
T ss_pred             HHHHHHHHHHHhccccccccccHHHHHHHHHHHhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCCCCCCCC
Confidence            99999999999999988777899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCcccCC
Q 002815          868 SPNDVKPVYI  877 (877)
Q Consensus       868 ~~~~~~~~~~  877 (877)
                      |++||+++||
T Consensus       689 ganDv~~I~l  698 (698)
T KOG0978|consen  689 GANDVHRIHL  698 (698)
T ss_pred             CcccccccCC
Confidence            9999999997



>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10929 putative mechanosensitive channel protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription] Back     alignment and domain information
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional Back     alignment and domain information
>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0972 consensus Huntingtin interacting protein 1 (Hip1) interactor Hippi [Signal transduction mechanisms] Back     alignment and domain information
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1; Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PRK04023 DNA polymerase II large subunit; Validated Back     alignment and domain information
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>KOG2991 consensus Splicing regulator [RNA processing and modification] Back     alignment and domain information
>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A Back     alignment and domain information
>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF15616 TerY-C: TerY-C metal binding domain Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>PF12660 zf-TFIIIC: Putative zinc-finger of transcription factor IIIC complex; InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1729 consensus FYVE finger containing protein [General function prediction only] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only] Back     alignment and domain information
>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PF08882 Acetone_carb_G: Acetone carboxylase gamma subunit; InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction: CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+ It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits) Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>KOG1937 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query877
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-21
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-15
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-14
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-14
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-13
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-13
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 5e-12
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 7e-12
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-11
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-10
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 6e-11
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-10
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 2e-10
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 2e-10
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-10
2ysl_A73 Tripartite motif-containing protein 31; ring-type 3e-10
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 4e-10
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 6e-10
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 9e-10
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-09
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-09
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-09
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 3e-09
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-09
2ecw_A85 Tripartite motif-containing protein 30; metal bind 3e-09
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-08
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 2e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-08
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 3e-08
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 3e-08
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 4e-08
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 4e-08
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 5e-08
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 5e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 7e-08
2ysj_A63 Tripartite motif-containing protein 31; ring-type 9e-08
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 1e-07
2ea5_A68 Cell growth regulator with ring finger domain prot 6e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-07
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 7e-07
2ecm_A55 Ring finger and CHY zinc finger domain- containing 8e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 6e-06
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 6e-06
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 9e-06
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 2e-05
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 4e-05
3nw0_A238 Non-structural maintenance of chromosomes element 4e-05
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 8e-05
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 97.6 bits (242), Expect = 8e-21
 Identities = 102/696 (14%), Positives = 207/696 (29%), Gaps = 174/696 (25%)

Query: 39  DTAVLQFQNQKLVQKLETQKVEYSALENKFAQLKERQQPYDSTLKVVNKSWEEL--ITDL 96
           +T   Q+Q + ++             E+ F    + +   D    +++K  EE+  I   
Sbjct: 10  ETGEHQYQYKDILS----------VFEDAFVDNFDCKDVQDMPKSILSK--EEIDHIIMS 57

Query: 97  ESCSMRARESSNGQESRCLSIIEDVTPHPSHDAFLSRLMETGATESSSADNCPNQME--- 153
           +               R    +           F+         E     N    M    
Sbjct: 58  KDAVSGTL--------RLFWTLLS-KQEEMVQKFV---------EEVLRINYKFLMSPIK 99

Query: 154 -EDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNL 212
            E R+  +     I        D L++              D     K + +       L
Sbjct: 100 TEQRQPSMMTRMYI-----EQRDRLYN--------------DNQVFAKYNVSRLQPYLKL 140

Query: 213 RLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNC-K--LAA-- 267
           R AL+           EL+  +++       ++ + G               K  +A   
Sbjct: 141 RQALL-----------ELRPAKNV------LIDGVLG-------------SGKTWVALDV 170

Query: 268 LRAERDVTKGAFFPV--LNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKG 325
             + + V     F +  LNL N +     +   Q+ L  ++       D +S+  L +  
Sbjct: 171 CLSYK-VQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHS 229

Query: 326 LHDGRIKVLQQLYNLQNTL------KSVKCLSSSKAF------------LSVKNQLEKSK 367
           +    ++ L +    +N L      ++ K      AF              V + L  + 
Sbjct: 230 IQA-ELRRLLKSKPYENCLLVLLNVQNAKAW---NAFNLSCKILLTTRFKQVTDFLSAAT 285

Query: 368 SEVFKYQALFEKLQVEKDNLAWRETE------LNMKI-DLVDVFRRSSAVTDS--KIADL 418
           +           L      L   E +      L+ +  DL         +T +  +++ +
Sbjct: 286 TTHI-------SLDHHSMTLTPDEVKSLLLKYLDCRPQDL-----PREVLTTNPRRLSII 333

Query: 419 GIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAAL 478
              I+   D     +   +  + +     I +    L    P +   M  +LS +     
Sbjct: 334 AESIR---DGLATWD-NWKHVNCDKLTTIIESSLNVLE---PAEYRKMFDRLSVFPP--- 383

Query: 479 DIHILRADVLSL------TNVLERKVKECE--TLLA-SSADQVAEIHKLQAMVQDLTDSN 529
             HI    +LSL       + +   V +    +L+     +    I  +   ++   ++ 
Sbjct: 384 SAHI-PTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLENE 442

Query: 530 LEL-KLILDMYR-RESTDSRDVLAARDLEYKAWAHV--HSLKSSLDEQSLELRVKTA--- 582
             L + I+D Y   ++ DS D++     +Y    H+  H       E+    R+      
Sbjct: 443 YALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYS-HIGHHLKNIEHPERMTLFRMVFLDFR 501

Query: 583 -IEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQS 641
            +E +         A   I +  Q+L+ +K  +       +     I  +L +IE     
Sbjct: 502 FLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKIEENLIC 561

Query: 642 YDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQ 677
                     LL+     +D  I    E    +Q+Q
Sbjct: 562 SKYT-----DLLRIALMAEDEAI--FEEA--HKQVQ 588


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query877
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.45
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.41
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.39
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.38
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.38
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.37
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.36
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.36
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.36
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.34
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.34
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.34
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.33
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.31
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.31
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.3
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.3
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.3
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.3
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 99.29
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.29
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.28
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.26
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.25
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.24
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.23
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.22
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.2
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.2
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.19
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.17
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.17
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.17
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.14
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.14
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.14
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.13
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.12
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.11
2ect_A78 Ring finger protein 126; metal binding protein, st 99.11
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.11
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.1
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.1
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.04
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.03
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.03
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.03
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.02
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.01
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.0
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.99
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.98
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.97
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.97
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.97
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.96
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.94
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.93
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.92
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.92
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.91
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.86
2ea5_A68 Cell growth regulator with ring finger domain prot 98.8
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.79
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.76
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.66
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 98.63
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.57
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.57
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.3
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.18
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.79
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.5
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.31
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.29
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.23
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.11
1joc_A125 EEA1, early endosomal autoantigen 1; FYVE domain, 96.91
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 96.43
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.22
3nw0_A238 Non-structural maintenance of chromosomes element 96.15
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 95.93
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 95.83
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.52
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 94.65
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.61
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.5
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 94.25
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 93.38
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 93.36
2b9c_A147 Striated-muscle alpha tropomyosin; alpha-helix, co 93.23
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 93.13
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 92.72
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 92.05
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 91.73
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.55
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 91.42
1z60_A59 TFIIH basal transcription factor complex P44 subun 90.65
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 90.37
1y02_A120 CARP2, FYVE-ring finger protein sakura; zinc-bindi 90.23
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 89.15
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 88.81
2k5c_A95 Uncharacterized protein PF0385; structural genomic 88.78
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 87.85
2fiy_A309 Protein FDHE homolog; FDHE protein, structural gen 87.67
3mpx_A434 FYVE, rhogef and PH domain-containing protein 5; s 87.08
2q6q_A74 Spindle POLE BODY component SPC42; SPC42P, budding 86.12
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 85.81
2zet_C153 Melanophilin; complex, GTP-binding protein, GTPase 85.67
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 85.18
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 82.96
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 82.63
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 82.33
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 82.25
1vd4_A62 Transcription initiation factor IIE, alpha subunit 81.79
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 81.75
1vfy_A73 Phosphatidylinositol-3-phosphate binding FYVE doma 81.51
2yw8_A82 RUN and FYVE domain-containing protein 1; structur 80.92
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
Probab=99.45  E-value=8.3e-14  Score=123.59  Aligned_cols=49  Identities=33%  Similarity=0.712  Sum_probs=44.1

Q ss_pred             CcccccccccccccccccccchhhhHHhHHHHhccCCCCCCCCCCCCCCC
Q 002815          821 EILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPN  870 (877)
Q Consensus       821 ~~l~C~~C~~~~~~~~~~~c~h~~c~~C~~~~~~~~~~~Cp~c~~~~~~~  870 (877)
                      +.+.|+||++.|.+|++++|||+||..|+..|+. ....||+||.++...
T Consensus        52 ~~~~C~iC~~~~~~~~~~~CgH~fc~~Ci~~~~~-~~~~CP~Cr~~~~~~  100 (138)
T 4ayc_A           52 NELQCIICSEYFIEAVTLNCAHSFCSYCINEWMK-RKIECPICRKDIKSK  100 (138)
T ss_dssp             HHSBCTTTCSBCSSEEEETTSCEEEHHHHHHHTT-TCSBCTTTCCBCCCE
T ss_pred             ccCCCcccCcccCCceECCCCCCccHHHHHHHHH-cCCcCCCCCCcCCCC
Confidence            3489999999999999999999999999999998 466799999999654



>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>1joc_A EEA1, early endosomal autoantigen 1; FYVE domain, inositol 3-phosphate binding, membrane protein; HET: ITP; 2.20A {Homo sapiens} SCOP: g.50.1.1 h.1.21.1 PDB: 1hyi_A* 1hyj_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1y02_A CARP2, FYVE-ring finger protein sakura; zinc-binding module, phosphoinositide binding, caspase regulation, metal binding protein; 1.80A {Homo sapiens} SCOP: a.140.2.1 g.50.1.1 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2fiy_A Protein FDHE homolog; FDHE protein, structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pseudomonas aeruginosa} SCOP: e.59.1.1 Back     alignment and structure
>3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} Back     alignment and structure
>2q6q_A Spindle POLE BODY component SPC42; SPC42P, budding yeast, cell cycle; 1.97A {Saccharomyces cerevisiae} Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2zet_C Melanophilin; complex, GTP-binding protein, GTPase, G-protein, RAB, RAB27B, effector, SLP homology domain, acetylation, lipoprotein, membrane; HET: GTP; 3.00A {Mus musculus} Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1vfy_A Phosphatidylinositol-3-phosphate binding FYVE domain of protein VPS27; endosome maturation, intracellular trafficking; 1.15A {Saccharomyces cerevisiae} SCOP: g.50.1.1 Back     alignment and structure
>2yw8_A RUN and FYVE domain-containing protein 1; structure genomics, structural genomics, NPPSFA; 3.00A {Homo sapiens} PDB: 2yqm_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 877
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 6e-17
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 4e-14
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-13
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-12
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 6e-09
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 2e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 3e-08
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-08
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 4e-08
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 6e-07
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-06
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 2e-05
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 1e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 0.002
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 0.003
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 0.003
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 74.2 bits (182), Expect = 6e-17
 Identities = 16/57 (28%), Positives = 25/57 (43%)

Query: 818 EYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKP 874
            + + + C IC     + V T C HLFC  C+ +  +     CP C     P D++ 
Sbjct: 19  HFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLES 75


>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query877
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.51
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.51
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.41
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.39
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.38
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.37
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.34
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.33
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.24
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.23
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.16
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.15
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.05
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.8
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.73
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.55
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.07
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 96.58
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 93.12
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 92.89
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 92.1
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 90.8
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 89.27
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 87.66
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 86.05
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 85.87
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 85.79
d2fiya1290 FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId 85.03
d1joca164 Eea1 {Human (Homo sapiens) [TaxId: 9606]} 84.09
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 82.3
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 81.37
d1wffa_85 ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus 80.81
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.51  E-value=2.9e-15  Score=122.74  Aligned_cols=69  Identities=35%  Similarity=0.721  Sum_probs=58.5

Q ss_pred             hHHHHHHHHHhccCcccccccccccccccccccchhhhHHhHHHHhccC--CCCCCCCCCCCCCCCCcccC
Q 002815          808 IIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESR--HRKCPGCAASFSPNDVKPVY  876 (877)
Q Consensus       808 ~~~~l~~~~~~l~~~l~C~~C~~~~~~~~~~~c~h~~c~~C~~~~~~~~--~~~Cp~c~~~~~~~~~~~~~  876 (877)
                      .+..++.-+..+...+.|+||++.|.+|++++|||+||..|+..|+...  ...||.||.++...++.+++
T Consensus         7 ~~~~~~~~~~~l~~~l~CpIC~~~~~~pv~~~CgH~fC~~Ci~~~~~~~~~~~~CP~Cr~~~~~~~l~~n~   77 (103)
T d1jm7a_           7 RVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQEST   77 (103)
T ss_dssp             SHHHHHHHHHHHHHHTSCSSSCCCCSSCCBCTTSCCCCSHHHHHHHHSSSSSCCCTTTSCCCCTTTCBCCC
T ss_pred             hHHHHHHHHHhcccCcCCCccCchhCCeEEcCCCCchhhHHHHHHHHHCCCCCcCcCCCCcCChhhCCcCH
Confidence            3455566666777779999999999999999999999999999998643  35799999999988888775



>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1joca1 g.50.1.1 (A:1348-1411) Eea1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wffa_ g.80.1.1 (A:) ANUBL1 (AN1, ubiquitin-like, homolog) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure