Citrus Sinensis ID: 002823

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870------

MGAQYESSLFSSSLSELFSRKLRLSSDIASYGHSVDTVSSHYEEEEPFESLEEIEAQTIGNLLPDDDDLFSGVTDGLECTVHPSGGSGGDDMDDLDFFSSVGGMDLGNDSSYVAQKKSEICIGFSNHELGVCNGAVAGEHLNDEHPSRTLLLRKINSNIEDSELKALFEQYGDVRTFYRASKHCGFVTISYYDIRAARNAMKSLQNKLTRSGKLDIHYSIPKDNPSEKEINQGTLVVFNLDSSVSNDELHHIFGVYGEIKEIRETPQKIHQKYIEFYDTRAAEAALRELNSRYIAGKQIKLEPSHLRGLRKCLANQLPPELEQEECGSYQQQNSPPNKPTNESAGMITIVISLPLNVKSLAIIYLFTGAFAHGSKSSRITDTCIVSVVPSAVKAPPTESAFHLGISSSVPSLVRMESFGTQSALAEPGHLQGQLKFNIRSTPSFHPHSLPECHDGLNKGVRCNSSGTKGANINIKPPEIIDSRHFSRVSSNGHSIGFTEVFGSASNGSCPRPGHQYSWNNSYCPQLPGMMWPNSPSLVSGIFNTYSPTRVHGLPRAPSHMVNTVLPIGSHHVGSAPTVDPSLWERQHAYVAESPEASGFHLGSHGSMRISNNSLHSVEFVSHNIFPCVGGNGMDMPLPSKNSVFQSHHQRSMMFSGRGQTIPLMNSFDPPNERARNRRNEGAVNQADKKQYELDIDRILRGEDNRTTLMIKNIPNKYTSKMLLAAIDERHKGTYDFIYLPIDFKNKCNVGYAFINMTDPSQIVPFYQSFNGKKWEKFNSEKVASLAYARIQGKAALIAHFQNSSLMNEDKRCRPILFNTDGPNAGDQVPFPMGVNFRTRPGKARSVIHEENHHGSPPNVEDLSNGDAPSGSAKESD

cccccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEccccccccccccccCEEEEEcccccccHHHHHHHHcccccEEEEEEccccccEEEEEEccHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHccccHHHHHcccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccHHHHccccccccEEEcccccccccHHHHHHHHHHcccccccEEEEccccccccccEEEEEEccccccHHHHHHHHcccccccccccEEEEEEEHHHHHHHHHHHHHccccccccccccccEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

**************SE****************************************QTIGNLLPDDDDLFSGVTDGLECTV**************DFFSSVGGMDLGNDSSYVAQKKSEICIGFSN********A****H**DEHPSRTLLLRKINSNIEDSELKALFEQYGDVRTFYRASKHCGFVTISYYDIRAARNAMKSLQNKLTRSGKLDIHY************NQGTLVVFNLDSSVSNDELHHIFGVYGEIKEIRETPQKIHQKYIEFYDTRAAEAALRELNSRYIAGKQIKLEPSHLR**R***************************************************I*YL******H*SKSS**T*TCIVSVVPSA******************************************************************************************************SIGFTEVFG**********GHQYSWNNSYCPQLPGMMWPNSPSLVSGIFNTYSPTRVHGLPRAPSHMVNTVLPIGSHHVGSAPTVDPSLWERQHAYV**********************SLHSVEFVSHNIFPCVGGN***********************************************************YELDIDRILRGEDNRTTLMIKNIPNKYTSKMLLAAIDERHKGTYDFIYLPIDFKNKCNVGYAFINMTDPSQIVPFYQSFNGKKWEKFNSEKVASLAYARIQGKAALIAHFQNSSLMNEDKRCRPILFNTDGPNAGDQV************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein MEI2-like 4	Probable RNA-binding protein that may play a role in growth regulation.	probable	Q64M78
Protein MEI2-like 3	Probable RNA-binding protein that may play a role in growth regulation.	probable	Q75M35
Protein MEI2-like 1	Probable RNA-binding transcriptional activator that plays a role in meiosis and vegetative growth. May be a downstream effector of TOR signaling pathway and recruited by RAPTOR1 for TOR substrate.	probable	Q8W4I9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 143-226
View the alignment between query and template
View the model in PyMOL

Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 148-219,231-307,338-369
View the alignment between query and template
View the model in PyMOL

Template: 2L08, chain A
Confidence level:probable
Coverage over the Query: 705-791
View the alignment between query and template
View the model in PyMOL