Citrus Sinensis ID: 002843


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870----
MDDMDEGVGEVAPVNAAEGAPLQNKEIEYSLRPESCNNVLESGEMAIPEGTSSDGSFQILADMLEGKSVNRIVSPMDASENPCPHSDSDAGIMVEELTVRKSNSSNLAIVGTSNHRERISTRHDRWQHLYQLGSGSGSGSSRGDRGHGRTMLGAWEDVGDTSLHDFITQKPLNDEHNTILEQSANTENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKTTLKGKGIVCRGPPLNAFKERRGMIDTKAFVTTTMPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGVPASCWIGGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKETLESASLDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYSKSSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHYLKKPLVDPSLQNESAPSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMRSQIQLSDSDSTTRADNDLLRDRENLFLAQQDQEIQNPTDRLGAFFDGLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLSTYCFRKKFVFTL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccEEccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccHHHccccccccEEEcccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEccccccccccccccccccccccHHHccccccccEEEccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHEEEcccccccccccccccHHHcccHHHHHHHHccccccccccccccHHcccccccccccEEEEEEEccccccccccEEEEcccccccHHHHcccccEEEEEEcccccccccccccccEEEEccccccEEEccccccccEEccccccEEEEEEcccccEEEEEccEEEcc
cccHHcccccccccHHHHHcHccccccccccccccHHHHHcccEEEEcccccccccccccccccccccccEEEcccccccccccccccccccEEEEEEEEccccccEEEEccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHccccccHHHHHHcccccccHHHHHHHcccccccccccccccccccEEEEccccccHHHHHHHcccccEEEcccccccccccccccccccccccccccHHHHcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHccccEEEEcHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHccccccEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEccccHHEEEEcccEEEEEEEccHEEcccccccccEEEEcccccEEEEEccHHHHHHEEccccccEEEEEEEcccEEEEEEEEEEEEc
mddmdegvgevapvnaaegaplqnkeieyslrpescnnvlesgemaipegtssdgsFQILADMLegksvnrivspmdasenpcphsdsdagIMVEELTVrksnssnlaivgtsnhreriSTRHDRWQHLYqlgsgsgsgssrgdrghgrtmlgawedvgdtslhdfitqkplndehntileqsantendglsgnmlshgsirtkmlsksgfseFFVKTTLkgkgivcrgpplnafkerrgmidtkafvtttmPSDAALKAAGAMMvasnaspkpvgVGTAVVsngsldlgartgvpascwigglrqgssdhgvNLREWLNarghkgkriECLYIFRQIVALVDYhhtqgvtfldlkpssfkllqsnqvkyigpiiqketlesasldiphsenyrlrRRSAEEEMFTTGIASAKkqkfnhnmnfsrwwslfpskygnkietanesdinevsiphshndtnehhtnagfgnysksssplvsntaqQQSTSVSEQLeekwyaspeelsggvcttssniysLGVLFFELFGRFDSERALAAAMSDLrdrilppsflsenpkeaGFCLwqlhpeplsrpttrEILQSEVTNEFQEVCAEELLssidqddsESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHylkkplvdpslqnesapsrenryfneqlssseaqlspisdanEMRLMRNLNQLERAYFSMRsqiqlsdsdsttradnDLLRDRENLFLAQqdqeiqnptdRLGAFFDGLCKYARYSKFEVQGMlrtgefnnsanvicsisfdrdedhfAAAGVSKKIKIFEFNalfndsvdvyypavemsnrsklscVCWNNYIKNYLASADYDGVVKVCMScrlstycfrkkFVFTL
MDDMDEGVGEvapvnaaegaplqnkeieyslRPESCNNVLESGEMAIPEGTSSDGSFQILADMLEGKSVNRIVSPMDASENPCPHSDSDAGIMVEELTVrksnssnlaivgtsnhrerisTRHDRWQHLYQlgsgsgsgssrgDRGHGRTMLGAWEDVGDTSLHDFITQKPLNDEHNTILEQSANTENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKttlkgkgivcrgpplnafkerrgMIDTKAFVTTTMPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGVPASCWIGGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKetlesasldiphsenYRLRRRSAEEEMFTTGiasakkqkfnhNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYSKSSSPLVSNTAQQQSTSVSEQLEEKWYAspeelsggvcTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERrhylkkplvdpslqnesapSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMrsqiqlsdsdsttrADNDLLRDRENLFLaqqdqeiqnptDRLGAFFDGLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLstycfrkkfvftl
MDDMDEGVGEVAPVNAAEGAPLQNKEIEYSLRPESCNNVLESGEMAIPEGTSSDGSFQILADMLEGKSVNRIVSPMDASENPCPHSDSDAGIMVEELTVRKSNSSNLAIVGTSNHRERISTRHDRWQHLYQLgsgsgsgssrgdrghgrTMLGAWEDVGDTSLHDFITQKPLNDEHNTILEQSANTENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKTTLKGKGIVCRGPPLNAFKERRGMIDTKAFVTTTMPSDaalkaagammvaSNASPKPVGVGTAVVSNGSLDLGARTGVPASCWIGGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKETLESASLDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYSKSSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHYLKKPLVDPSLQNESAPSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMRSQIQLSDSDSTTRADNDLLRDRENLFLAQQDQEIQNPTDRLGAFFDGLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLSTYCFRKKFVFTL
*******************************************************************************************************************************************************LGAWEDVGDTSLHDFIT****************************************SGFSEFFVKTTLKGKGIVCRGPPLNAFKERRGMIDTKAFVTTTM**********************VGVGTAVVSNGSLDLGARTGVPASCWIGGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKET************************************KFNHNMNFSRWWSLFPSKYGNK******************************************************************LSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFL****KEAGFCLWQLHP****************TNEFQEVCAEEL************LLLHFLISL*******************************************************************************************************************************TDRLGAFFDGLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLSTYCFRKKFVF**
********GEVAPV******************************************FQILA*MLE**SVNRIVS******************MVEELTVR*****************************Y************************************************************************************************************************************************************************************HGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKETLESASLDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYSKS*******************LEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDDSESELLLHF**********************************************************************************LNQLERAYF*************************************************GLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLSTYCFRKKFVFTL
*********EVAPVNAAEGAPLQNKEIEYSLRPESCNNVLESGEMAIPEGTSSDGSFQILADMLEGKSVNRIVSPMD*********DSDAGIMVEELTVRKSNSSNLAIVGTSNHRERISTRHDRWQHLYQLG**************GRTMLGAWEDVGDTSLHDFITQKPLNDEHNTILEQSANTENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKTTLKGKGIVCRGPPLNAFKERRGMIDTKAFVTTTMPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGVPASCWIGGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKETLESASLDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYS***********************EKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHYLKKPLVDPSLQNESAPSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMRSQ***********ADNDLLRDRENLFLAQQDQEIQNPTDRLGAFFDGLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLSTYCFRKKFVFTL
*******V*EVAPVNAAEGAPLQNKEIEYSLRPESCNNVLESGEMAIPEGTSSDGSFQILADMLEGKSVNRIVSPMDASENPCPHSDSDAGIMVEELTVRKSNSSNLAIVGTSNHRERISTRHDRWQHLYQLGSG***************************LHD***********NTILEQSA*TENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKTTLKGKGIVCRGPPLNAFK***************************M******SP****************L********************DHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPI*****************************************************************************************************************SVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRH************************************PISDANEMRLMRNLNQLERAYFSMRSQIQ****************************EIQNPTDRLGAFFDGLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLSTYCFRKKFVFTL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDMDEGVGEVAPVNAAEGAPLQNKEIEYSLRPESCNNVLESGEMAIPEGTSSDGSFQILADMLEGKSVNRIVSPMDASENPCPHSDSDAGIMVEELTVRKSNSSNLAIVGTSNHRERISTRHDRWQHLYQLGSGSGSGSSRGDRGHGRTMLGAWEDVGDTSLHDFITQKPLNDEHNTILEQSANTENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKTTLKGKGIVCRGPPLNAFKERRGMIDTKAFVTTTMPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGVPASCWIGGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKETLESASLDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYSKSSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDDSESELLLHFLISLxxxxxxxxxxxxxxxxxxxxxxxxxxxxHYLKKPLVDPSLQNESAPSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMRSQIQLSDSDSTTRADNDLLRDRENLFLAQQDQEIQNPTDRLGAFFDGLCKYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCWNNYIKNYLASADYDGVVKVCMSCRLSTYCFRKKFVFTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query874 2.2.26 [Sep-21-2011]
Q9T014 1036 Protein SPA1-RELATED 2 OS yes no 0.900 0.759 0.440 1e-175
Q9SYX2 1029 Protein SUPPRESSOR OF PHY no no 0.814 0.691 0.385 1e-123
Q9LJR3 845 Protein SPA1-RELATED 3 OS no no 0.540 0.558 0.321 6e-72
Q94BM7 794 Protein SPA1-RELATED 4 OS no no 0.407 0.448 0.385 8e-61
P43254 675 E3 ubiquitin-protein liga no no 0.300 0.389 0.290 1e-27
P93471 672 E3 ubiquitin-protein liga N/A no 0.286 0.372 0.299 2e-27
Q8NHY2 731 E3 ubiquitin-protein liga yes no 0.250 0.299 0.314 1e-24
Q9R1A8 733 E3 ubiquitin-protein liga yes no 0.250 0.298 0.310 5e-24
Q9Z1Z11108 Eukaryotic translation in no no 0.104 0.082 0.311 7e-08
Q55F451078 Probable serine/threonine no no 0.143 0.115 0.314 1e-07
>sp|Q9T014|SPA2_ARATH Protein SPA1-RELATED 2 OS=Arabidopsis thaliana GN=SPA2 PE=1 SV=2 Back     alignment and function desciption
 Score =  615 bits (1585), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 380/863 (44%), Positives = 505/863 (58%), Gaps = 76/863 (8%)

Query: 4   MDEG-VGEVAPVNAAEGAPLQNKEIEYSLRPESCNNVLESGEMAIP-EGTSSDGSFQILA 61
           MDEG VG+V+ ++ A+ A LQ K  E S +PE+   V E  E+ +  E  S D S+ ++A
Sbjct: 2   MDEGSVGDVSRIDEADVAHLQFKNSEQSFKPENIE-VREVKEVQVQREAGSPDCSYGVIA 60

Query: 62  DMLEGKSVNRIVSPMDASENPCP--HSDSDAGIMVEELTVRKSNSSNLAIVGTSNHRERI 119
           D L+GK+    V  +     PC    + +D G +VEELTV+    S++AIVG  + R R+
Sbjct: 61  DFLDGKNGGDHVELI--GNEPCSSRQNTNDEGDVVEELTVKTCEGSSMAIVGRPSSRARL 118

Query: 120 STRHDRWQHLYQLGSGSGSGSSRGDRGHGRTMLGAWEDVGDTSLHDF----ITQKPLNDE 175
                ++ H + L       SS   +   R  +    + G  SL +     +    +N E
Sbjct: 119 EMNRSQFLHRFPLDGDLPGSSSMSKKVIDRGTVSILRNAGKMSLPETSNGQLAIIAVNGE 178

Query: 176 HNTILEQSANTENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKTTLKGKGIVCRGPPLNAF 235
            N   E   N E + +    LSH  I+TKMLS+SGFS+FFV+ TLKGKG+  RGPP N  
Sbjct: 179 AN---EHLTNVERNPVPVEALSHEGIKTKMLSQSGFSQFFVRKTLKGKGVTFRGPPNNRS 235

Query: 236 KERRGMIDTKAFVTTTMPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGV 295
           K R     T A             ++G+ +V +N S K          +G   L + T  
Sbjct: 236 KARNMDQQTVA-------------SSGSALVIANTSAKISSSIPLAAYDGLPCLPSNTSK 282

Query: 296 PASCW-IGGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLD 354
           P+SC       +G    G++LREWL +   +  + EC+YIFRQIV  VD  H+QGV   D
Sbjct: 283 PSSCANPSDTHRGCGGEGLSLREWLKSERQEVNKAECMYIFRQIVDHVDCSHSQGVVLCD 342

Query: 355 LKPSSFKLLQSNQVKYIGPIIQKETLESA--SLDIPHSENYRLRRRSAEEEMFTTGIASA 412
           L+PSSFK+ + N VKY+    Q+E+ +S      +   EN  +RRR  +    +     A
Sbjct: 343 LRPSSFKIFKENAVKYVVSGSQRESFDSNMNKETLSQLENPLVRRRLGDTSSLSI---PA 399

Query: 413 KKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYSK 472
           KKQK +     SR W +F    G  I+T N    N+ +I   H  +++ H        S 
Sbjct: 400 KKQKSSGPS--SRQWPMFQRAGGVNIQTEN----NDGAIQEFHFRSSQPHC-------ST 446

Query: 473 SSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSE 532
            + P          TSVSEQLEEKWYASPEEL G + + SSNIYSLG+L +EL  +F  E
Sbjct: 447 VACPF---------TSVSEQLEEKWYASPEELRGDMRSASSNIYSLGILLYELLSQFQCE 497

Query: 533 RALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVC 592
           RA  AAMSD+R RILPP FLSENPKEAGFCLW LHPE   RP+TR+ILQSEV N   ++ 
Sbjct: 498 RAREAAMSDIRHRILPPKFLSENPKEAGFCLWLLHPESSCRPSTRDILQSEVVNGIPDLY 557

Query: 593 AEELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHYLKKPL 652
           AE L  SI+Q+D+ESELL HFL   +E++Q  A  L+ EI S+EADI+E+ +R     P 
Sbjct: 558 AEGLSLSIEQEDTESELLQHFLFLSQEKRQKHAGNLMEEIASVEADIEEIVKRRCAIGP- 616

Query: 653 VDPSLQNESAPSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMRSQIQL 712
             PSL+  S+ S                    S   EMRL+RN+NQLE AYF+ R    L
Sbjct: 617 --PSLEEASSSSPA------------------SSVPEMRLIRNINQLESAYFAARIDAHL 656

Query: 713 SDSDSTTRADNDLLRDRENLFLAQQDQEIQNPTDRLGAFFDGLCKYARYSKFEVQGMLRT 772
            ++    R D DLLR+ +N     ++ E  +  DR+GAFFDGLCKYARYSKFE +G+LRT
Sbjct: 657 PEARYRLRPDRDLLRNSDNTVAEVENSETWSSDDRVGAFFDGLCKYARYSKFETRGVLRT 716

Query: 773 GEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLS 832
            E NN++NVICS+ FDRDED+FA AGVSKKIKI+EFN+LFN+SVD++YPA+EM NRSKLS
Sbjct: 717 SELNNTSNVICSLGFDRDEDYFATAGVSKKIKIYEFNSLFNESVDIHYPAIEMPNRSKLS 776

Query: 833 CVCWNNYIKNYLASADYDGVVKV 855
            VCWNNYI+NYLAS+DYDG+VK+
Sbjct: 777 GVCWNNYIRNYLASSDYDGIVKL 799




Involved in suppression of photomorphogenesis in dark-grown seedlings. Probably part of the COP1/SPA E3 ubiquitin-protein ligase complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SYX2|SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana GN=SPA1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJR3|SPA3_ARATH Protein SPA1-RELATED 3 OS=Arabidopsis thaliana GN=SPA3 PE=1 SV=1 Back     alignment and function description
>sp|Q94BM7|SPA4_ARATH Protein SPA1-RELATED 4 OS=Arabidopsis thaliana GN=SPA4 PE=1 SV=1 Back     alignment and function description
>sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 Back     alignment and function description
>sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1 Back     alignment and function description
>sp|Q8NHY2|RFWD2_HUMAN E3 ubiquitin-protein ligase RFWD2 OS=Homo sapiens GN=RFWD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9R1A8|RFWD2_MOUSE E3 ubiquitin-protein ligase RFWD2 OS=Mus musculus GN=Rfwd2 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z1Z1|E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus GN=Eif2ak3 PE=1 SV=1 Back     alignment and function description
>sp|Q55F45|Y8642_DICDI Probable serine/threonine-protein kinase DDB_G0268642 OS=Dictyostelium discoideum GN=DDB_G0268642 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query874
255537717 1044 ubiquitin ligase protein cop1, putative 0.913 0.764 0.564 0.0
359473903 1054 PREDICTED: protein SPA1-RELATED 2-like, 0.919 0.762 0.541 0.0
224075074 1020 predicted protein [Populus trichocarpa] 0.891 0.763 0.504 0.0
449452259 1036 PREDICTED: protein SPA1-RELATED 2-like [ 0.898 0.757 0.495 0.0
356495711 1129 PREDICTED: protein SPA1-RELATED 2-like [ 0.939 0.727 0.464 0.0
356540404 1103 PREDICTED: protein SPA1-RELATED 2-like [ 0.921 0.729 0.467 0.0
356527668 1012 PREDICTED: protein SPA1-RELATED 2-like [ 0.867 0.749 0.459 0.0
357481459 1323 Histone acetyltransferase type B subunit 0.816 0.539 0.484 1e-180
297809331 1032 hypothetical protein ARALYDRAFT_911432 [ 0.898 0.760 0.437 1e-175
145340093 1036 protein SPA1-related 2 [Arabidopsis thal 0.900 0.759 0.440 1e-173
>gi|255537717|ref|XP_002509925.1| ubiquitin ligase protein cop1, putative [Ricinus communis] gi|223549824|gb|EEF51312.1| ubiquitin ligase protein cop1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/861 (56%), Positives = 591/861 (68%), Gaps = 63/861 (7%)

Query: 4   MDEGVG-EVAPVNAAEGAPLQNKEIEYSLRPESCNNVLESGEMAIP-EGTSSDGSFQILA 61
           MDEG+G E+AP+N  E A L +KE EYS++P   +NVLES E+ IP EG  ++ SF +LA
Sbjct: 1   MDEGLGDEMAPLNMTERAHLHSKENEYSIKPPESSNVLESHEIIIPGEGDYTESSFHVLA 60

Query: 62  DMLEGKSVNRIVSPMDASENPC--PHSDSDAGIMVEELTVRKSNSSNLAIVGTSNHRERI 119
           D+L+ K++NR   PMDASE  C  P    +AG MVEELTVR  +SSNLAIVGTSN RERI
Sbjct: 61  DILDAKNLNRSGVPMDASEQLCTNPRFMDNAGNMVEELTVRNYDSSNLAIVGTSNFRERI 120

Query: 120 STRHDRWQHLYQLGSGSGSGSSRGD---RGHGRTMLGAWEDVGDTSLHDFITQKPLNDEH 176
            TR  +WQHLYQLG  SG GSS      R +G+ M    ED    S   F++ K  +D+ 
Sbjct: 121 QTRQGQWQHLYQLGGASGIGSSCTKTLYRDNGQEMSSPLEDARYASSPVFLSHKTSSDDC 180

Query: 177 NTILEQSANTENDGLSGNMLSHGSIRTKMLSKSGFSEFFVKTTLKGKGIVCRGPPLNAFK 236
           N ++EQSAN +N GLS NM+SHG IRTK+LSKSGFSE+FVK+TLKGKGI+ RGP      
Sbjct: 181 NEVVEQSANAKNKGLSQNMISHGGIRTKILSKSGFSEYFVKSTLKGKGIIFRGP------ 234

Query: 237 ERRGMIDTKAFVTTTMPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGVP 296
                                    GA +   N +       T   SN SL+LG +T +P
Sbjct: 235 ----------------------THEGAKLAPRNENTGKAATVTLAASNSSLNLGVKTTLP 272

Query: 297 ASCWIGGLRQGSSDH-GVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDL 355
            S  I G R   +DH G+ L+ WLNAR HK  +++CL+IF++IV LVDY H++GV   DL
Sbjct: 273 CSFGITGPRPAGADHDGIGLQHWLNARQHKVNKVDCLHIFKRIVDLVDYSHSKGVALHDL 332

Query: 356 KPSSFKLLQSNQVKYIGPIIQKETLESA-SLDIPHSENYRLRRRSAEEEMFTTGIASAKK 414
           +PS FKLLQSNQV YIG  ++K+T + A   D+P +EN+  RRR+AE+ +F      AKK
Sbjct: 333 RPSCFKLLQSNQVNYIGSAVEKDTFDRAMDRDVPSTENHVARRRAAEQGIFPFVGILAKK 392

Query: 415 QKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTNAGFGNYSKSS 474
           QKF+ N N  R W LF +K+G K ETAN+ D+   S   S ++  EH  N  +    + S
Sbjct: 393 QKFSENANSLRQWPLFTAKHGLKFETANDGDLGLASTQDSRSEVAEHIPNTEYRIQGRIS 452

Query: 475 SPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERA 534
             L SN AQQQ  S++++LE+KWYASPEELS G+CT SSNIYSLGVL FEL G FDSER 
Sbjct: 453 HQL-SNAAQQQLASITDRLEDKWYASPEELSQGICTMSSNIYSLGVLLFELLGHFDSERG 511

Query: 535 LAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAE 594
            A AM+DLR RILPP FLSENPKEAGFCLW +HPEP SRPTTREILQSEV N  QEV  E
Sbjct: 512 HATAMADLRHRILPPHFLSENPKEAGFCLWLIHPEPSSRPTTREILQSEVINGLQEVSVE 571

Query: 595 ELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHYLKKPLVD 654
           EL SSIDQDD+ESELLLHFL  L+E KQN ASKL  EIR +EADI EV RR+ L+K L +
Sbjct: 572 ELSSSIDQDDAESELLLHFLCLLKEHKQNHASKLADEIRCIEADIGEVARRNCLEKSLAN 631

Query: 655 PSLQNESAPSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMRSQIQLSD 714
                                    QLS +S  N+MRL   + QLE AYFSMRSQIQL  
Sbjct: 632 -------------------------QLSCVSRTNDMRLNNIIRQLESAYFSMRSQIQLPK 666

Query: 715 SDSTTRADNDLLRDRENLFLAQQDQEIQNPTDRLGAFFDGLCKYARYSKFEVQGMLRTGE 774
           +D+TT  D D+LR+REN + A +  E +NPTD LG+FFDGLCKYARYSKFEV+G+LRTG+
Sbjct: 667 TDATTNQDMDVLRNRENCYFALEGDEKENPTDCLGSFFDGLCKYARYSKFEVRGLLRTGD 726

Query: 775 FNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCV 834
           FNNSANVICS+SFDRD D+FA AGVSKKIKIFEFN+L NDSVD++YP +EMSN+SKLSC+
Sbjct: 727 FNNSANVICSLSFDRDMDYFATAGVSKKIKIFEFNSLLNDSVDIHYPVIEMSNKSKLSCI 786

Query: 835 CWNNYIKNYLASADYDGVVKV 855
           CWN YIKNYLAS DYDGVVK+
Sbjct: 787 CWNTYIKNYLASTDYDGVVKL 807




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359473903|ref|XP_002271391.2| PREDICTED: protein SPA1-RELATED 2-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|224075074|ref|XP_002304547.1| predicted protein [Populus trichocarpa] gi|222841979|gb|EEE79526.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449452259|ref|XP_004143877.1| PREDICTED: protein SPA1-RELATED 2-like [Cucumis sativus] gi|449501807|ref|XP_004161464.1| PREDICTED: protein SPA1-RELATED 2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356495711|ref|XP_003516717.1| PREDICTED: protein SPA1-RELATED 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356540404|ref|XP_003538679.1| PREDICTED: protein SPA1-RELATED 2-like [Glycine max] Back     alignment and taxonomy information
>gi|356527668|ref|XP_003532430.1| PREDICTED: protein SPA1-RELATED 2-like [Glycine max] Back     alignment and taxonomy information
>gi|357481459|ref|XP_003611015.1| Histone acetyltransferase type B subunit [Medicago truncatula] gi|355512350|gb|AES93973.1| Histone acetyltransferase type B subunit [Medicago truncatula] Back     alignment and taxonomy information
>gi|297809331|ref|XP_002872549.1| hypothetical protein ARALYDRAFT_911432 [Arabidopsis lyrata subsp. lyrata] gi|297318386|gb|EFH48808.1| hypothetical protein ARALYDRAFT_911432 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145340093|ref|NP_192849.4| protein SPA1-related 2 [Arabidopsis thaliana] gi|223635833|sp|Q9T014.2|SPA2_ARATH RecName: Full=Protein SPA1-RELATED 2 gi|332657574|gb|AEE82974.1| protein SPA1-related 2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query874
TAIR|locus:2039139 1029 SPA1 "SUPPRESSOR OF PHYA-105 1 0.425 0.361 0.531 8.2e-118
TAIR|locus:2136133 1036 SPA2 "SPA1-related 2" [Arabido 0.273 0.230 0.510 3.5e-108
TAIR|locus:2037005 794 SPA4 "SPA1-related 4" [Arabido 0.299 0.329 0.336 1.2e-36
TAIR|locus:2059359 675 COP1 "CONSTITUTIVE PHOTOMORPHO 0.194 0.251 0.374 1.4e-24
DICTYBASE|DDB_G0288453 970 DDB_G0288453 "E3 ubiquitin-pro 0.204 0.184 0.358 8.7e-24
ZFIN|ZDB-GENE-070410-134 694 rfwd2 "ring finger and WD repe 0.314 0.396 0.303 1.3e-23
UNIPROTKB|F1NQ64 717 RFWD2 "Uncharacterized protein 0.312 0.380 0.285 9.9e-22
UNIPROTKB|Q8NHY2 731 RFWD2 "E3 ubiquitin-protein li 0.308 0.369 0.286 1.3e-21
MGI|MGI:1347046 733 Rfwd2 "ring finger and WD repe 0.308 0.368 0.286 1.7e-21
UNIPROTKB|E2RRJ5 733 RFWD2 "Uncharacterized protein 0.308 0.368 0.286 2.2e-21
TAIR|locus:2039139 SPA1 "SUPPRESSOR OF PHYA-105 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 945 (337.7 bits), Expect = 8.2e-118, Sum P(3) = 8.2e-118
 Identities = 208/391 (53%), Positives = 268/391 (68%)

Query:   469 NYSKSSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGR 528
             +Y K+ S  VS+ +++QS  +S  LEE+WY  PEE++G      SNIY+LGVL FEL   
Sbjct:   417 DYIKNLS--VSSVSRKQS--MSTWLEEQWYTCPEEINGEDIGEKSNIYALGVLLFELLCH 472

Query:   529 FDSERALAAAMSDLRDRILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEF 588
              +S    AA M+DLR RILPP+FLS+ PKEAGFCLW LHPEP SRP+ R+IL+SE+    
Sbjct:   473 CESGEMHAAMMADLRHRILPPTFLSKYPKEAGFCLWLLHPEPSSRPSARDILKSEL---- 528

Query:   589 QEVCAEELLSSIDQDDSESELLLHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHYL 648
               +C ++ + S    +  SELLLHFL SLE +K+ +ASKL+ +I++LE DIKE ERR+  
Sbjct:   529 --ICEDDSVKSTAAAEEISELLLHFLSSLEVQKKKKASKLLQDIQTLEDDIKEAERRYSS 586

Query:   649 KKPLVDPSLQNESAPSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMRS 708
                LV      E     ++   +E  ++S A   P   AN  RLM N+ QLE AYF MRS
Sbjct:   587 NVSLVRSHGAIEKRV--QSSPLDEHCTTSSALFVPT--ANTDRLMSNIRQLEDAYFFMRS 642

Query:   709 QIQLSDSDSTTRADNDLL-RDR--ENLFLAQQDQEIQNPT-DRLGAFFDGLCKYARYSKF 764
             QI LS S +T R+D  L  RDR  EN     QD   +  + D+L  FF+GLCK+ARYSKF
Sbjct:   643 QINLSSSAATARSDKTLKDRDRCSENQN-ENQDMSTKGKSSDQLEVFFEGLCKFARYSKF 701

Query:   765 EVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVE 824
             E  G +R+G+  NSA+V+CS+SFD DE+H AAAG+SKKIKIF+FNA  N+SV V+YP VE
Sbjct:   702 ETCGTIRSGDLLNSASVVCSLSFDPDEEHIAAAGISKKIKIFDFNAFMNESVGVHYPLVE 761

Query:   825 MSNRSKLSCVCWNNYIKNYLASADYDGVVKV 855
             M N+SKLSCVCWN+YIKNYLAS DYDGVV++
Sbjct:   762 MVNKSKLSCVCWNSYIKNYLASTDYDGVVQI 792


GO:0004672 "protein kinase activity" evidence=IEA
GO:0004871 "signal transducer activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005834 "heterotrimeric G-protein complex" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0009640 "photomorphogenesis" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0048575 "short-day photoperiodism, flowering" evidence=IMP
GO:0010100 "negative regulation of photomorphogenesis" evidence=RCA;IMP
GO:2000028 "regulation of photoperiodism, flowering" evidence=IMP
GO:0010017 "red or far-red light signaling pathway" evidence=IMP
GO:0010114 "response to red light" evidence=IEP
GO:0010218 "response to far red light" evidence=IEP
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0042802 "identical protein binding" evidence=IPI
GO:0009658 "chloroplast organization" evidence=IMP
GO:0006281 "DNA repair" evidence=RCA
GO:0048608 "reproductive structure development" evidence=RCA
GO:0009585 "red, far-red light phototransduction" evidence=IGI
TAIR|locus:2136133 SPA2 "SPA1-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037005 SPA4 "SPA1-related 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059359 COP1 "CONSTITUTIVE PHOTOMORPHOGENIC 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288453 DDB_G0288453 "E3 ubiquitin-protein ligase RFWD2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-134 rfwd2 "ring finger and WD repeat domain 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQ64 RFWD2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NHY2 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1347046 Rfwd2 "ring finger and WD repeat domain 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRJ5 RFWD2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00002463001
SubName- Full=Chromosome chr2 scaffold_132, whole genome shotgun sequence; (1006 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query874
PLN00181 793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 1e-74
PLN00181 793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 9e-07
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 1e-06
pfam00069260 pfam00069, Pkinase, Protein kinase domain 2e-05
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-05
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 8e-04
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 8e-04
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 0.001
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 0.004
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
 Score =  260 bits (665), Expect = 1e-74
 Identities = 148/385 (38%), Positives = 215/385 (55%), Gaps = 23/385 (5%)

Query: 493 LEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFL 552
           +E  WY SPEE +G     +S++Y LGVL FELF    S    +  MS LR R+LPP  L
Sbjct: 176 MEMSWYTSPEEDNGSSSNCASDVYRLGVLLFELFCPVSSREEKSRTMSSLRHRVLPPQIL 235

Query: 553 SENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCAEELLSSIDQDD--SESELL 610
              PKEA FCLW LHPEP  RP+  E+LQSE  NE +E   EE  ++++  D   E ELL
Sbjct: 236 LNWPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRE-NLEEREAAMELRDRIEEQELL 294

Query: 611 LHFLISLEEEKQNQASKLVGEIRSLEADIKEVERRHYLKKP--------LVDPSLQNESA 662
           L FL  +++ KQ  A KL   I  L +DI +V +R  + +         L       + A
Sbjct: 295 LEFLFLIQQRKQEAADKLQDTISLLSSDIDQVVKRQLVLQQKGSDVRSFLASRKRIRQGA 354

Query: 663 PSRENRYFNEQLSSSEAQLSPISDANEMRLMRNLNQLERAYFSMR-SQIQLSDSD----- 716
            +      N+  SS        +     RLMRNL +LE  YF+ R  QI+ + +      
Sbjct: 355 ETLAAEEENDDNSSKLDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAAAAAEKPLA 414

Query: 717 --STTRADNDLLRDRENLFLAQQDQEIQNPTDRLGA----FFDGLCKYARYSKFEVQGML 770
              +  ++N    ++ ++    +  +      R G     F +GLCKY  +SK  V+  L
Sbjct: 415 RYYSALSENGRSSEKSSMSNPAKPPDFYINDSRQGGWIDPFLEGLCKYLSFSKLRVKADL 474

Query: 771 RTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSK 830
           + G+  NS+N++C+I FDRD + FA AGV+KKIKIFE  ++  D  D++YP VE+++RSK
Sbjct: 475 KQGDLLNSSNLVCAIGFDRDGEFFATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSK 534

Query: 831 LSCVCWNNYIKNYLASADYDGVVKV 855
           LS +CWN+YIK+ +AS++++GVV+V
Sbjct: 535 LSGICWNSYIKSQVASSNFEGVVQV 559


Length = 793

>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 874
PLN00181 793 protein SPA1-RELATED; Provisional 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0575592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 99.98
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 99.98
PTZ00267478 NIMA-related protein kinase; Provisional 99.98
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.98
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.98
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 99.98
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.98
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.98
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.98
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.97
PTZ00283496 serine/threonine protein kinase; Provisional 99.97
KOG0589426 consensus Serine/threonine protein kinase [General 99.97
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.97
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.97
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.97
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.97
KOG0582516 consensus Ste20-like serine/threonine protein kina 99.97
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.97
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.97
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 99.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.97
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.97
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.97
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 99.97
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.97
KOG0201467 consensus Serine/threonine protein kinase [Signal 99.97
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
KOG0611668 consensus Predicted serine/threonine protein kinas 99.97
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.97
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.97
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
KOG0610459 consensus Putative serine/threonine protein kinase 99.97
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.97
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.97
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.97
PHA02988283 hypothetical protein; Provisional 99.97
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.97
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.97
PHA03212391 serine/threonine kinase US3; Provisional 99.97
KOG4721 904 consensus Serine/threonine protein kinase, contain 99.97
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
KOG0694694 consensus Serine/threonine protein kinase [Signal 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
PTZ00284467 protein kinase; Provisional 99.97
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.97
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.97
PTZ00036440 glycogen synthase kinase; Provisional 99.97
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
PHA03209357 serine/threonine kinase US3; Provisional 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.97
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.97
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.97
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.97
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.97
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.97
PHA03207392 serine/threonine kinase US3; Provisional 99.97
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.97
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.97
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.97
KOG0584632 consensus Serine/threonine protein kinase [General 99.97
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.97
KOG0596677 consensus Dual specificity; serine/threonine and t 99.97
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
PHA03211461 serine/threonine kinase US3; Provisional 99.97
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.96
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.96
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.96
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.96
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.96
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.96
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.96
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.96
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.96
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.96
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.96
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.96
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.96
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.96
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.96
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.96
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.96
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.96
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.96
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.96
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.96
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.96
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.96
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.96
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.96
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.96
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.96
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.96
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.96
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.96
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.96
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.96
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 99.96
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.96
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.96
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.96
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.96
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.96
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.96
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.96
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.96
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.96
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.96
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.96
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.96
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.96
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.96
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.96
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.96
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.96
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.96
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.96
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.96
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.96
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.96
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.96
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.96
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.96
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.96
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.96
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.96
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.96
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.96
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.96
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.96
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.96
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.96
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.96
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.96
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.96
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.96
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.96
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.96
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.96
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.96
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.96
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.96
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.96
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.96
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.96
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.96
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.96
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.96
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.96
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.96
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.96
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.96
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.96
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.96
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.96
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.96
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.96
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.96
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.96
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.95
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.95
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.95
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.95
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.95
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.95
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.95
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.95
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.95
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.95
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.95
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.95
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.95
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.95
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.95
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.95
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.95
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.95
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.95
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.95
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.95
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.95
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.95
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.95
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.95
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.95
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.95
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.95
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.95
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.95
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.95
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.95
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.95
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.95
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.95
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.95
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.95
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.95
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.95
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.95
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.95
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.95
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 99.95
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.95
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.95
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.95
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.95
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.95
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.95
PHA03210501 serine/threonine kinase US3; Provisional 99.95
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.95
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.95
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.95
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.95
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.95
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.95
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.95
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.95
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.95
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.95
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.95
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.95
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.95
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.95
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.95
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.95
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.95
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.95
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.95
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.95
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.95
KOG0586596 consensus Serine/threonine protein kinase [General 99.95
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.95
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.95
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.95
PLN00009294 cyclin-dependent kinase A; Provisional 99.95
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.95
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.95
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.95
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.95
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.95
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.95
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.95
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.95
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.95
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.95
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.95
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 99.95
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.95
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.95
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.95
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.95
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.95
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.95
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.95
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.94
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.94
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.94
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.94
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.94
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.94
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.94
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.94
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.94
KOG1027903 consensus Serine/threonine protein kinase and endo 99.94
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.94
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.94
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.94
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.94
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.94
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.94
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.94
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.94
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.94
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.94
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.94
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.94
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.94
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.94
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.94
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.94
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.94
PHA02882294 putative serine/threonine kinase; Provisional 99.93
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.93
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.93
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.93
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.93
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.93
KOG4257974 consensus Focal adhesion tyrosine kinase FAK, cont 99.93
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.93
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.93
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.93
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.93
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.92
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.92
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.92
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.92
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.92
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.92
PLN03224507 probable serine/threonine protein kinase; Provisio 99.92
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.91
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.91
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.91
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.9
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.9
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.89
KOG1290590 consensus Serine/threonine protein kinase [Signal 99.89
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.89
KOG3653534 consensus Transforming growth factor beta/activin 99.89
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.88
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.88
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.86
KOG10251177 consensus Epidermal growth factor receptor EGFR an 99.86
KOG1167418 consensus Serine/threonine protein kinase of the C 99.86
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.86
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.86
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.85
KOG1152772 consensus Signal transduction serine/threonine kin 99.78
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.78
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.77
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.74
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.64
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.61
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.61
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.56
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.55
PRK09188365 serine/threonine protein kinase; Provisional 99.54
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 99.51
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.44
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.43
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 99.42
KOG1023484 consensus Natriuretic peptide receptor, guanylate 99.41
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.4
KOG0279 315 consensus G protein beta subunit-like protein [Sig 99.36
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.34
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.34
KOG0265 338 consensus U5 snRNP-specific protein-like factor an 99.33
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.33
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.3
PRK10345210 hypothetical protein; Provisional 99.3
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.29
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.29
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.28
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.25
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.25
KOG0263707 consensus Transcription initiation factor TFIID, s 99.24
PRK12274218 serine/threonine protein kinase; Provisional 99.24
PTZ00421 493 coronin; Provisional 99.23
KOG0266 456 consensus WD40 repeat-containing protein [General 99.2
PRK14879211 serine/threonine protein kinase; Provisional 99.19
KOG0275 508 consensus Conserved WD40 repeat-containing protein 99.19
KOG0263 707 consensus Transcription initiation factor TFIID, s 99.19
KOG0266 456 consensus WD40 repeat-containing protein [General 99.18
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.17
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.15
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.14
PTZ00420 568 coronin; Provisional 99.13
KOG0285 460 consensus Pleiotropic regulator 1 [RNA processing 99.13
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.12
KOG06061205 consensus Microtubule-associated serine/threonine 99.12
KOG0284 464 consensus Polyadenylation factor I complex, subuni 99.11
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.1
smart00090237 RIO RIO-like kinase. 99.09
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.07
KOG0645 312 consensus WD40 repeat protein [General function pr 99.03
KOG0302440 consensus Ribosome Assembly protein [General funct 99.02
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.02
PTZ00421 493 coronin; Provisional 99.01
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.0
PTZ00420 568 coronin; Provisional 99.0
KOG0273 524 consensus Beta-transducin family (WD-40 repeat) pr 98.99
KOG0275 508 consensus Conserved WD40 repeat-containing protein 98.98
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 98.98
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 98.97
KOG0270 463 consensus WD40 repeat-containing protein [Function 98.97
KOG0295406 consensus WD40 repeat-containing protein [Function 98.97
KOG1266458 consensus Protein kinase [Signal transduction mech 98.96
KOG0302440 consensus Ribosome Assembly protein [General funct 98.92
KOG0269 839 consensus WD40 repeat-containing protein [Function 98.92
KOG0285 460 consensus Pleiotropic regulator 1 [RNA processing 98.9
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 98.9
KOG0282 503 consensus mRNA splicing factor [Function unknown] 98.88
KOG0283 712 consensus WD40 repeat-containing protein [Function 98.88
KOG0315 311 consensus G-protein beta subunit-like protein (con 98.87
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 98.86
KOG0313423 consensus Microtubule binding protein YTM1 (contai 98.85
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 98.84
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 98.84
KOG0310 487 consensus Conserved WD40 repeat-containing protein 98.83
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 98.83
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 98.82
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 98.82
KOG0293519 consensus WD40 repeat-containing protein [Function 98.81
PLN00181 793 protein SPA1-RELATED; Provisional 98.81
KOG0316 307 consensus Conserved WD40 repeat-containing protein 98.79
KOG0283 712 consensus WD40 repeat-containing protein [Function 98.77
KOG0282 503 consensus mRNA splicing factor [Function unknown] 98.75
KOG0284 464 consensus Polyadenylation factor I complex, subuni 98.75
KOG0315311 consensus G-protein beta subunit-like protein (con 98.75
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 98.74
KOG4283 397 consensus Transcription-coupled repair protein CSA 98.74
KOG0303 472 consensus Actin-binding protein Coronin, contains 98.74
KOG0640 430 consensus mRNA cleavage stimulating factor complex 98.73
KOG0647 347 consensus mRNA export protein (contains WD40 repea 98.73
KOG1407 313 consensus WD40 repeat protein [Function unknown] 98.73
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.72
KOG0293 519 consensus WD40 repeat-containing protein [Function 98.72
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.72
KOG0289506 consensus mRNA splicing factor [General function p 98.71
KOG0295406 consensus WD40 repeat-containing protein [Function 98.71
KOG0286343 consensus G-protein beta subunit [General function 98.69
KOG0313423 consensus Microtubule binding protein YTM1 (contai 98.67
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.66
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.4e-60  Score=581.27  Aligned_cols=493  Identities=35%  Similarity=0.565  Sum_probs=357.1

Q ss_pred             eEeeccCCCCHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHHCCCcccCCCCCceEEecCCcEEEeccccchhcccccc
Q 002843          305 RQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKETLESAS  384 (874)
Q Consensus       305 lvMEy~~GgsL~~~L~~~~~~lse~e~~~I~~QIl~aL~yLHs~gIIHRDLKPsNILL~~~~~vKLiDFGlar~~~~~~~  384 (874)
                      +.|||+ +++|.+||......+++.+++.|++||+.||+|||++|||||||||+||||+..+.+|++|||++.....+  
T Consensus        57 ~~~e~~-~~~L~~~l~~~~~~~~~~~~~~i~~qi~~al~~lH~~gIvHrDlKP~NiLl~~~~~~k~~d~~~~~~~~~~--  133 (793)
T PLN00181         57 RALECE-DVSLRQWLDNPDRSVDAFECFHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSD--  133 (793)
T ss_pred             hhhccC-CccHHHHHhcccccccHHHHHHHHHHHHHHHHHHHhCCeeeccCCchhEEEcccCcEEEeeccccCccccc--
Confidence            467876 57999999876557999999999999999999999999999999999999999999999999998754311  


Q ss_pred             CCCCcchhhhhhcccchhhhccccchhhhhhhcccccccccccccCCCccCCccccccccccccccCCCCCCCCcccccc
Q 002843          385 LDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEHHTN  464 (874)
Q Consensus       385 ~~~~~~d~~~~r~r~~ei~dfg~~~~~~k~~kl~~~~~s~~~~~~~~~~~g~~~~~~~~~~l~~~~~~~~d~~~~~~~~~  464 (874)
                                 .....++.|||.+.......                      ....+  ..                  
T Consensus       134 -----------~~~~~ki~DfG~a~~~~~~~----------------------~~~~~--~~------------------  160 (793)
T PLN00181        134 -----------EDATTKSREIGSSRREEILS----------------------ERRIE--KL------------------  160 (793)
T ss_pred             -----------ccCccccccccccccccccc----------------------ccchh--hh------------------
Confidence                       11234566777654210000                      00000  00                  


Q ss_pred             cCcCCCCCCCCCcccccccccccccccccccccccCcccccCCCCCCccchhHHHHHHHHhcCCCCchHHHHHHHHHhhc
Q 002843          465 AGFGNYSKSSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRD  544 (874)
Q Consensus       465 ~~~~dfg~s~~p~~~~~~~~~~~~~t~~~GT~~Y~APEvl~g~~ys~kSDIwSLGVIL~ELltG~~p~~~~~~~~~~l~~  544 (874)
                         .......++          ......+||++|||||++.+..|+.++|||||||+||||++|++|+......+..+..
T Consensus       161 ---~~~~~~~~~----------~~~~~~~gt~~Y~APE~~~~~~~~~~sDVwSlGviL~ELl~~~~~~~~~~~~~~~~~~  227 (793)
T PLN00181        161 ---EEVKKQPFP----------MKQILAMEMSWYTSPEEDNGSSSNCASDVYRLGVLLFELFCPVSSREEKSRTMSSLRH  227 (793)
T ss_pred             ---hccccCCCc----------ccccccCCCcceEChhhhccCCCCchhhhhhHHHHHHHHhhCCCchhhHHHHHHHHHH
Confidence               000000000          1113468999999999999999999999999999999999999998876666667766


Q ss_pred             CCCCCCCCCCCHHHHHHHHHccccCCCCCCChhHHhhhHHHHhhHhhhh-hhhhccccccchhHHHHHHHHHHHHHHHHH
Q 002843          545 RILPPSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQEVCA-EELLSSIDQDDSESELLLHFLISLEEEKQN  623 (874)
Q Consensus       545 ~~lpp~~~~~~p~l~dLi~~cL~~dP~~RPTa~EiL~hp~~~~~~~~~~-~e~~~~ieqeeaE~elL~eFL~~l~qqKqe  623 (874)
                      ..+|+.+....+...+++.+||+++|.+||++.|+|+||||........ .+......+...+.+.+.+|+...++++++
T Consensus       228 ~~~~~~~~~~~~~~~~~~~~~L~~~P~~Rps~~eil~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~  307 (793)
T PLN00181        228 RVLPPQILLNWPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRENLEEREAAMELRDRIEEQELLLEFLFLIQQRKQE  307 (793)
T ss_pred             hhcChhhhhcCHHHHHHHHHhCCCChhhCcChHHHhhchhhhhhhHHhhhhhhhhhhhhhhhhHHHHHHHHHHHHHHHHH
Confidence            6777766666778889999999999999999999999999987654332 222223333344456667888888899999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhccCCCCCccccCCCCcccccccccccc----c------ccc-ccCCcccchhHHHH
Q 002843          624 QASKLVGEIRSLEADIKEVERRHYLKKPLVDPSLQNESAPSRENRYFNEQL----S------SSE-AQLSPISDANEMRL  692 (874)
Q Consensus       624 el~eLQ~ELq~LeeDi~eVEr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~------~~~-~~~~~~~~~~~~r~  692 (874)
                      ++.+++.+++.|+.||+++++++.+.........  ..... ++++.....    .      .+. ......+.+.++||
T Consensus       308 ~~~~~~~~~~~l~~~i~~~~~r~~~~~~~~~~~~--~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~l~~~~~~  384 (793)
T PLN00181        308 AADKLQDTISLLSSDIDQVVKRQLVLQQKGSDVR--SFLAS-RKRIRQGAETLAAEEENDDNSSKLDDTLESTLLESSRL  384 (793)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhhhhhcccccccc--ccccc-chhhhccccchhhccccccccccccccccccchhhhHH
Confidence            9999999999999999999998765432111110  00011 111110000    0      000 01111223458999


Q ss_pred             HHhHHHHHHHHhhhhhccccCCCCCcccccchhhhh--------hh-------hhhhh-hccccccCCCCccchhhhhcc
Q 002843          693 MRNLNQLERAYFSMRSQIQLSDSDSTTRADNDLLRD--------RE-------NLFLA-QQDQEIQNPTDRLGAFFDGLC  756 (874)
Q Consensus       693 ~~~~~~l~~~y~~~r~~~~~~~~~~~~~~~~d~~~~--------~~-------~~~~~-~~~~~~~~~~~~l~~f~~~l~  756 (874)
                      |+||++|++|||++|++......    ...+.+.+.        +.       +.+.+ .....+.....|+++|+++||
T Consensus       385 ~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~gl~  460 (793)
T PLN00181        385 MRNLKKLESVYFATRYRQIKAAA----AAEKPLARYYSALSENGRSSEKSSMSNPAKPPDFYINDSRQGGWIDPFLEGLC  460 (793)
T ss_pred             HHHHHHHHHHHhhhhhccccccc----cccccccccccccccccccccccccccccccccccccccccccchhhhhhhhh
Confidence            99999999999999986532210    111111110        00       00000 011112456788999999999


Q ss_pred             ceeeeeceeEeEEecccCCCCCCCCeeEEEECCCCCEEEEecCCCcEEEeeCCCCCCCCcccccCeeeecCCCceeEEEE
Q 002843          757 KYARYSKFEVQGMLRTGEFNNSANVICSISFDRDEDHFAAAGVSKKIKIFEFNALFNDSVDVYYPAVEMSNRSKLSCVCW  836 (874)
Q Consensus       757 ~~~ry~~~~~~~~l~~~~~~~~~~~V~si~F~~d~~~lAT~g~dk~Ikiwd~~~~~~~~~~~~~p~~~~~~~~~v~~l~w  836 (874)
                      |+++++++++.+.++.|++.+|++.|++|+|+|||++|||||.|++|+|||+.+......+.|+|+..+.++++|.+++|
T Consensus       461 ~~~~~~~~~~~~~~~~~~~~~~~~~V~~i~fs~dg~~latgg~D~~I~iwd~~~~~~~~~~~~~~~~~~~~~~~v~~l~~  540 (793)
T PLN00181        461 KYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGEFFATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSKLSGICW  540 (793)
T ss_pred             hhhcccceEEEEeeccccccCCCCcEEEEEECCCCCEEEEEeCCCEEEEEECCcccccccccccceEEecccCceeeEEe
Confidence            99999999999999999999999999999999999999999999999999998755555567889998888899999999


Q ss_pred             eCCCCCEEEEeeCCCcEEEEeCCCccc---eeeeeeeeee
Q 002843          837 NNYIKNYLASADYDGVVKVCMSCRLST---YCFRKKFVFT  873 (874)
Q Consensus       837 np~~~~~laS~~~Dg~V~~WD~~~~~~---~~~~~~f~~~  873 (874)
                      +|+++++||||++||+|+|||+.+++.   +.+|...|++
T Consensus       541 ~~~~~~~las~~~Dg~v~lWd~~~~~~~~~~~~H~~~V~~  580 (793)
T PLN00181        541 NSYIKSQVASSNFEGVVQVWDVARSQLVTEMKEHEKRVWS  580 (793)
T ss_pred             ccCCCCEEEEEeCCCeEEEEECCCCeEEEEecCCCCCEEE
Confidence            998899999999999999999987643   6677776665



>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query874
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 2e-08
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 4e-07
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 3e-04
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 3e-04
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 29/93 (31%), Positives = 48/93 (51%) Query: 492 QLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSF 551 Q+ K Y SPE++ G + +I+SLG++ FEL F ++ ++D+R+ PP F Sbjct: 190 QVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYPFSTQMERVRTLTDVRNLKFPPLF 249 Query: 552 LSENPKEAGFCLWQLHPEPLSRPTTREILQSEV 584 + P E L P P+ RP I+++ V Sbjct: 250 TQKYPCEYVMVQDMLSPSPMERPEAINIIENAV 282
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query874
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 2e-18
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 5e-05
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-14
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 8e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-08
3ork_A311 Serine/threonine protein kinase; structural genomi 3e-08
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 7e-08
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 8e-07
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-04
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-06
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-06
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-05
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 2e-04
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-04
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-04
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-04
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 4e-04
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 4e-04
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 5e-04
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 6e-04
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 7e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-04
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 9e-04
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
 Score = 86.5 bits (214), Expect = 2e-18
 Identities = 25/86 (29%), Positives = 44/86 (51%)

Query: 498 YASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAAAMSDLRDRILPPSFLSENPK 557
           Y SPE++ G   +   +I+SLG++ FEL   F ++      ++D+R+   P  F  + P+
Sbjct: 242 YMSPEQIHGNNYSHKVDIFSLGLILFELLYSFSTQMERVRIITDVRNLKFPLLFTQKYPQ 301

Query: 558 EAGFCLWQLHPEPLSRPTTREILQSE 583
           E       L P P  RP   +I+++ 
Sbjct: 302 EHMMVQDMLSPSPTERPEATDIIENA 327


>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query874
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.98
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.98
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.98
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.98
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.98
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.98
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.98
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.98
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.98
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.98
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.98
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.98
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.98
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.98
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.98
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.98
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.98
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.98
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.98
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.98
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.98
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.98
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.98
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.98
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.98
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.98
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.98
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.98
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.98
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.98
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.98
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.98
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.98
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.97
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.97
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.97
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.97
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.97
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.97
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.97
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.97
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.97
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.97
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.97
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.97
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.97
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.97
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.97
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.97
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.97
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.97
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.97
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.97
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.97
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.97
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.97
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.97
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.97
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.97
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.97
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.97
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.97
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.97
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.97
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.97
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.97
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.97
3soc_A322 Activin receptor type-2A; structural genomics cons 99.97
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.97
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.97
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.97
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.97
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.97
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.97
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.97
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.97
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.97
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.97
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.97
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.97
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.97
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.97
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.97
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.97
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.97
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.97
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.97
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.97
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.97
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.97
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.97
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.97
3q4u_A301 Activin receptor type-1; structural genomics conso 99.97
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.97
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.97
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.97
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.97
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.97
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.97
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.97
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.97
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.97
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.97
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.97
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.97
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.97
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.97
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.97
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.97
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.97
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.97
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.97
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.97
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.97
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.97
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.97
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.97
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.97
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.97
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.97
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.97
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.97
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.97
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.97
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.97
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.97
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.96
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.96
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.96
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.96
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.96
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.96
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.96
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.96
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.96
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.96
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.96
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.96
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.95
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.95
3uqc_A286 Probable conserved transmembrane protein; structur 99.93
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.91
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.73
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.5
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.38
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.35
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.34
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.34
2pm7_B 297 Protein transport protein SEC13, protein transport 99.32
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.31
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.3
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.3
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.28
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.27
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.27
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.27
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.26
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.24
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.24
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.23
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.23
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.23
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.23
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.23
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.21
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.21
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.21
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.2
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.2
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.2
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.19
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.19
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.19
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.19
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.18
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.18
2pm7_B 297 Protein transport protein SEC13, protein transport 99.17
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.17
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.16
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.15
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.15
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.15
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.13
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.12
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.12
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.11
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.1
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.09
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.09
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.08
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.07
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 99.07
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.07
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.05
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.04
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.03
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.02
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.01
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.0
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.0
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.0
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.0
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 98.99
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.99
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 98.99
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 98.99
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.99
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 98.98
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 98.98
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.98
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 98.98
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 98.98
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.97
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 98.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 98.96
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 98.94
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 98.94
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 98.94
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.93
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 98.93
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.92
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.92
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 98.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.92
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 98.92
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 98.92
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 98.92
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.91
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.9
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.9
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 98.9
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.89
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 98.89
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 98.89
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 98.89
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.89
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 98.89
3jrp_A 379 Fusion protein of protein transport protein SEC13 98.89
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 98.89
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.89
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 98.87
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 98.87
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 98.86
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.86
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.86
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 98.86
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 98.86
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 98.85
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 98.85
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.84
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 98.84
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 98.83
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.83
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 98.83
3jro_A 753 Fusion protein of protein transport protein SEC13 98.82
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 98.82
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 98.8
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 98.79
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 98.79
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.78
3jro_A 753 Fusion protein of protein transport protein SEC13 98.78
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 98.75
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.72
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 98.71
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.66
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.64
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.61
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.6
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.54
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.5
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.44
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.43
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.39
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.28
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.17
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.98
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.98
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.95
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 97.92
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.89
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.85
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.83
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.79
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.78
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.74
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.74
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.73
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 97.72
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 97.72
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.7
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 97.67
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 97.66
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.62
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.62
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.61
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.55
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.54
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.51
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.51
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 97.47
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.47
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.43
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.41
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.41
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.4
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.39
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.38
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.3
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.27
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.27
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.25
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 97.14
3r70_A320 Aminoglycoside phosphotransferase; structural geno 97.08
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 97.02
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.01
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 97.01
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.98
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 96.86
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 96.84
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.82
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 96.66
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 96.65
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 96.65
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 96.64
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 96.62
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.58
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.49
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.42
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 96.38
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 96.37
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.09
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 96.03
3fvz_A 329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.03
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 95.99
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 95.94
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.91
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.83
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 95.77
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 95.55
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.04
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 95.04
3ats_A357 Putative uncharacterized protein; hypothetical pro 95.02
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 94.79
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 94.77
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 94.67
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 94.67
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 94.46
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 94.43
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.42
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 94.37
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.36
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 93.99
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 93.86
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 93.83
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 93.44
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 93.44
2q83_A346 YTAA protein; 2635576, structural genomics, joint 93.37
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 93.3
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 92.85
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 92.75
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 92.44
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 91.84
2qe8_A 343 Uncharacterized protein; structural genomics, join 91.83
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 91.76
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 91.71
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 91.69
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 91.48
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 90.82
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 90.74
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 90.56
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 90.53
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 90.22
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 89.28
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 89.25
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 89.11
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 88.95
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 88.57
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 88.37
2qe8_A 343 Uncharacterized protein; structural genomics, join 87.56
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 87.37
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 86.29
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 85.24
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 85.19
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 85.04
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 84.28
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 84.1
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 83.97
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 83.9
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 83.55
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 82.43
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
Probab=100.00  E-value=8.2e-44  Score=395.55  Aligned_cols=242  Identities=17%  Similarity=0.199  Sum_probs=188.3

Q ss_pred             CceEEEecCCCCcccccccccccccccccCCChhHHHHHHHHhHHhhcCCCCCceeccceeecCcccCCcCCCCCccccC
Q 002843          222 GKGIVCRGPPLNAFKERRGMIDTKAFVTTTMPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGVPASCWI  301 (874)
Q Consensus       222 gkGvv~kg~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (874)
                      ++|+||++..    ... ++..+.+.+......+......|..+++...||++|.+++....++..              
T Consensus        86 ~fG~V~~a~~----~~t-g~~vAiK~i~~~~~~~~~~~~~Ei~il~~l~HpnIV~l~~~~~~~~~~--------------  146 (346)
T 4fih_A           86 STGIVCIATV----RSS-GKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDEL--------------  146 (346)
T ss_dssp             SSCEEEEEEE----TTT-CCEEEEEEEEGGGCSSGGGGHHHHHHHHHCCCTTBCCEEEEEEETTEE--------------
T ss_pred             cCeEEEEEEE----CCC-CCEEEEEEEecCchhHHHHHHHHHHHHHhCCCCCCCcEEEEEEECCEE--------------
Confidence            3466777752    111 122233333333233334456677888899999999999987765543              


Q ss_pred             CCceEeeccCCCCHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHHCCCcccCCCCCceEEecCCcEEEeccccchhccc
Q 002843          302 GGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQGVTFLDLKPSSFKLLQSNQVKYIGPIIQKETLE  381 (874)
Q Consensus       302 ~~~lvMEy~~GgsL~~~L~~~~~~lse~e~~~I~~QIl~aL~yLHs~gIIHRDLKPsNILL~~~~~vKLiDFGlar~~~~  381 (874)
                        ++|||||+||+|.+++.+.  .+++.+++.|++||+.||+|||++|||||||||+||||+.++.+||+|||+|+.+..
T Consensus       147 --~ivmEy~~gg~L~~~l~~~--~l~e~~~~~~~~qi~~aL~ylH~~~IiHRDlKp~NILl~~~g~vKl~DFGla~~~~~  222 (346)
T 4fih_A          147 --WVVMEFLEGGALTDIVTHT--RMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSK  222 (346)
T ss_dssp             --EEEECCCTTEEHHHHHHHS--CCCHHHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTTCCEEECCCTTCEECCS
T ss_pred             --EEEEeCCCCCcHHHHHHcC--CCCHHHHHHHHHHHHHHHHHHHHCCcccccCCHHHEEECCCCCEEEecCcCceecCC
Confidence              4599999999999999875  599999999999999999999999999999999999999999999999999874330


Q ss_pred             cccCCCCcchhhhhhcccchhhhccccchhhhhhhcccccccccccccCCCccCCccccccccccccccCCCCCCCCccc
Q 002843          382 SASLDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNEH  461 (874)
Q Consensus       382 ~~~~~~~~~d~~~~r~r~~ei~dfg~~~~~~k~~kl~~~~~s~~~~~~~~~~~g~~~~~~~~~~l~~~~~~~~d~~~~~~  461 (874)
                      .                                                                               
T Consensus       223 ~-------------------------------------------------------------------------------  223 (346)
T 4fih_A          223 E-------------------------------------------------------------------------------  223 (346)
T ss_dssp             S-------------------------------------------------------------------------------
T ss_pred             C-------------------------------------------------------------------------------
Confidence            0                                                                               


Q ss_pred             ccccCcCCCCCCCCCcccccccccccccccccccccccCcccccCCCCCCccchhHHHHHHHHhcCCCCchHH--HHHHH
Q 002843          462 HTNAGFGNYSKSSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERA--LAAAM  539 (874)
Q Consensus       462 ~~~~~~~dfg~s~~p~~~~~~~~~~~~~t~~~GT~~Y~APEvl~g~~ys~kSDIwSLGVIL~ELltG~~p~~~--~~~~~  539 (874)
                                              ....+..+||++|||||++.+..|+.++||||||||||||++|.+||..  ....+
T Consensus       224 ------------------------~~~~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~  279 (346)
T 4fih_A          224 ------------------------VPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAM  279 (346)
T ss_dssp             ------------------------SCCBCCCCSCGGGCCHHHHTTCCBCTHHHHHHHHHHHHHHHHSSCTTTTSCHHHHH
T ss_pred             ------------------------CCcccccccCcCcCCHHHHCCCCCCcHHHHHHHHHHHHHHHHCCCCCCCcCHHHHH
Confidence                                    0001456899999999999999999999999999999999999999843  22334


Q ss_pred             HHhhcCCCC--CCCCCCCHHHHHHHHHccccCCCCCCChhHHhhhHHHHhhH
Q 002843          540 SDLRDRILP--PSFLSENPKEAGFCLWQLHPEPLSRPTTREILQSEVTNEFQ  589 (874)
Q Consensus       540 ~~l~~~~lp--p~~~~~~p~l~dLi~~cL~~dP~~RPTa~EiL~hp~~~~~~  589 (874)
                      ..+.....+  +.+...++.+.+||.+||.+||++|||+.|+|+||||+...
T Consensus       280 ~~i~~~~~~~~~~~~~~s~~~~dli~~~L~~dP~~R~ta~e~l~Hp~~~~~~  331 (346)
T 4fih_A          280 KMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAG  331 (346)
T ss_dssp             HHHHHSSCCCCSCGGGSCHHHHHHHHHHSCSSTTTSCCHHHHTTCGGGGGCC
T ss_pred             HHHHcCCCCCCCccccCCHHHHHHHHHHcCCChhHCcCHHHHhcCHhhcCCC
Confidence            445443322  22334568899999999999999999999999999998643



>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 874
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 2e-09
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 4e-04
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-09
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 5e-09
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 7e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-08
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-08
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-08
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-08
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 9e-08
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-04
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 1e-07
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-07
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 0.003
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-07
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-07
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-07
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 3e-07
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-07
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-07
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 0.003
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 4e-07
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-07
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 5e-07
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 0.002
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 9e-07
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 1e-06
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-06
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-06
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-06
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-06
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-06
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 2e-06
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-06
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 3e-06
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-06
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 5e-06
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 5e-06
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-06
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-06
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 7e-06
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 9e-06
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 0.003
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-05
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-05
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-05
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-04
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-04
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-04
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-04
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 4e-04
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 5e-04
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 0.001
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.003
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 0.004
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 57.7 bits (139), Expect = 2e-09
 Identities = 19/93 (20%), Positives = 41/93 (44%), Gaps = 8/93 (8%)

Query: 497 WYASPEELSGGVCTTSSNIYSLGVLFFEL------FGRFDSERALAAAMSDLRDRILPPS 550
           ++ +PE ++        +I+SLG++  E+      +   +  RAL    ++    +  P 
Sbjct: 181 YWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPE 240

Query: 551 FLSENPKEAGFCLWQLHPEPLSRPTTREILQSE 583
            LS   ++  F    L  +   R + +E+LQ +
Sbjct: 241 KLSAIFRD--FLNRCLDMDVEKRGSAKELLQHQ 271


>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query874
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.97
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.96
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.48
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.45
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.28
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.27
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.26
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.24
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 99.23
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.16
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.15
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.14
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.11
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.09
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.09
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.06
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.05
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.03
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.03
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.02
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.02
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.01
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.01
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.99
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.92
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.9
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 98.85
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.76
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.71
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.65
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.63
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.59
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.54
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.48
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.42
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 98.21
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.18
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.08
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.07
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.04
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.99
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 97.96
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 97.65
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 97.6
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.36
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.31
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.18
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 97.04
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.89
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.79
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 96.58
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 96.35
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 95.33
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 95.09
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 94.48
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 92.66
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 92.34
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 91.65
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 90.07
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 90.07
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 87.6
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 87.28
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 86.87
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 86.75
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Dual specificity mitogen-activated protein kinase kinase 1, Mek1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=9.6e-42  Score=373.09  Aligned_cols=240  Identities=17%  Similarity=0.195  Sum_probs=182.3

Q ss_pred             ceEEEecCCCCcccccccccccccccccC-CChhHHHHHHHHhHHhhcCCCCCceeccceeecCcccCCcCCCCCccccC
Q 002843          223 KGIVCRGPPLNAFKERRGMIDTKAFVTTT-MPSDAALKAAGAMMVASNASPKPVGVGTAVVSNGSLDLGARTGVPASCWI  301 (874)
Q Consensus       223 kGvv~kg~~~~~~~~~~~~~~~~~~~~~~-~~~d~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (874)
                      .|+||++..    .. .++..+++.++.. .+........+..+++...||+++.+++....++..              
T Consensus        19 fg~V~~~~~----~~-~~~~vAiK~i~~~~~~~~~~~~~~Ei~il~~l~HpnIv~l~~~~~~~~~~--------------   79 (322)
T d1s9ja_          19 GGVVFKVSH----KP-SGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEI--------------   79 (322)
T ss_dssp             SCCEEEEEE----TT-TTEEEEEEEEECCCCTTHHHHHHHHGGGGGGCCCTTBCCEEEEEECSSEE--------------
T ss_pred             CeEEEEEEE----CC-CCcEEEEEEEChhhCHHHHHHHHHHHHHHHhCCCCCCCcEEEEEEECCEE--------------
Confidence            366777751    11 1223333444332 233445566788899999999999999987755543              


Q ss_pred             CCceEeeccCCCCHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHHHC-CCcccCCCCCceEEecCCcEEEeccccchhcc
Q 002843          302 GGLRQGSSDHGVNLREWLNARGHKGKRIECLYIFRQIVALVDYHHTQ-GVTFLDLKPSSFKLLQSNQVKYIGPIIQKETL  380 (874)
Q Consensus       302 ~~~lvMEy~~GgsL~~~L~~~~~~lse~e~~~I~~QIl~aL~yLHs~-gIIHRDLKPsNILL~~~~~vKLiDFGlar~~~  380 (874)
                        ++|||||+||+|.++|.+.+ .+++.+++.++.||+.||+|||++ |||||||||+||||+.++.+||+|||+|+...
T Consensus        80 --~iVmEy~~gg~L~~~l~~~~-~l~~~~~~~~~~qil~aL~yLH~~~~IiHRDiKP~NILl~~~~~vkl~DFGla~~~~  156 (322)
T d1s9ja_          80 --SICMEHMDGGSLDQVLKKAG-RIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLI  156 (322)
T ss_dssp             --EEEEECCTTEEHHHHHHHHS-SCCHHHHHHHHHHHHHHHHHHHHHHCCCCSCCSGGGEEECTTCCEEECCCCCCHHHH
T ss_pred             --EEEEEcCCCCcHHHHHhhcC-CCCHHHHHHHHHHHHHHHHHHHHhCCEEccccCHHHeeECCCCCEEEeeCCCccccC
Confidence              46999999999999998776 699999999999999999999974 99999999999999999999999999987433


Q ss_pred             ccccCCCCcchhhhhhcccchhhhccccchhhhhhhcccccccccccccCCCccCCccccccccccccccCCCCCCCCcc
Q 002843          381 ESASLDIPHSENYRLRRRSAEEEMFTTGIASAKKQKFNHNMNFSRWWSLFPSKYGNKIETANESDINEVSIPHSHNDTNE  460 (874)
Q Consensus       381 ~~~~~~~~~~d~~~~r~r~~ei~dfg~~~~~~k~~kl~~~~~s~~~~~~~~~~~g~~~~~~~~~~l~~~~~~~~d~~~~~  460 (874)
                      +.                                                                              
T Consensus       157 ~~------------------------------------------------------------------------------  158 (322)
T d1s9ja_         157 DS------------------------------------------------------------------------------  158 (322)
T ss_dssp             HH------------------------------------------------------------------------------
T ss_pred             CC------------------------------------------------------------------------------
Confidence            00                                                                              


Q ss_pred             cccccCcCCCCCCCCCcccccccccccccccccccccccCcccccCCCCCCccchhHHHHHHHHhcCCCCchHHHHH---
Q 002843          461 HHTNAGFGNYSKSSSPLVSNTAQQQSTSVSEQLEEKWYASPEELSGGVCTTSSNIYSLGVLFFELFGRFDSERALAA---  537 (874)
Q Consensus       461 ~~~~~~~~dfg~s~~p~~~~~~~~~~~~~t~~~GT~~Y~APEvl~g~~ys~kSDIwSLGVIL~ELltG~~p~~~~~~---  537 (874)
                                                 ..+..+||++|||||++.+.+|+.++|||||||++|||++|..||.....   
T Consensus       159 ---------------------------~~~~~~GT~~Y~APEvl~~~~y~~~~DiWSlGvil~ell~G~~Pf~~~~~~~~  211 (322)
T d1s9ja_         159 ---------------------------MANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKEL  211 (322)
T ss_dssp             ---------------------------TC---CCSSCCCCHHHHHCSCCCTTHHHHHHHHHHHHHHHSSCCSSCCCTTHH
T ss_pred             ---------------------------ccccccCCccccCchHHcCCCCCcHHHHHHHHHHHHHHHHCCCCCCCCCHHHH
Confidence                                       00345899999999999999999999999999999999999988732100   


Q ss_pred             -H----------------------------------------HHHhhcCCCCCCCC--CCCHHHHHHHHHccccCCCCCC
Q 002843          538 -A----------------------------------------MSDLRDRILPPSFL--SENPKEAGFCLWQLHPEPLSRP  574 (874)
Q Consensus       538 -~----------------------------------------~~~l~~~~lpp~~~--~~~p~l~dLi~~cL~~dP~~RP  574 (874)
                       .                                        ...+.. ..++...  ..++.+.+||.+||.+||.+||
T Consensus       212 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~s~~~~dli~~~L~~dP~~R~  290 (322)
T d1s9ja_         212 ELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVN-EPPPKLPSGVFSLEFQDFVNKCLIKNPAERA  290 (322)
T ss_dssp             HHHC------------------------------CCCCHHHHHHHHHT-SCCCCCCBTTBCHHHHHHHHHHTCSSTTTSC
T ss_pred             HHHHHHHhcCCcccCCcccccccccccccccccccchhHHHHHhhhhc-cCCccCccccCCHHHHHHHHHHcCCChhHCc
Confidence             0                                        000000 1112221  2346789999999999999999


Q ss_pred             ChhHHhhhHHHHhhHh
Q 002843          575 TTREILQSEVTNEFQE  590 (874)
Q Consensus       575 Ta~EiL~hp~~~~~~~  590 (874)
                      |+.|+|+||||+....
T Consensus       291 ta~e~L~Hpf~~~~~~  306 (322)
T d1s9ja_         291 DLKQLMVHAFIKRSDA  306 (322)
T ss_dssp             CHHHHHTSHHHHHHHH
T ss_pred             CHHHHhhCHhhCcCCc
Confidence            9999999999987553



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure