BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 002894
         (869 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1Z2I|A Chain A, Crystal Structure Of Agrobacterium Tumefaciens Malate
           Dehydrogenase, New York Structural Genomics Consortium
 pdb|1Z2I|B Chain B, Crystal Structure Of Agrobacterium Tumefaciens Malate
           Dehydrogenase, New York Structural Genomics Consortium
 pdb|1Z2I|C Chain C, Crystal Structure Of Agrobacterium Tumefaciens Malate
           Dehydrogenase, New York Structural Genomics Consortium
 pdb|1Z2I|D Chain D, Crystal Structure Of Agrobacterium Tumefaciens Malate
           Dehydrogenase, New York Structural Genomics Consortium
          Length = 358

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 90  ASNTSNRGGRGGTDRYGVRSGAAYFTSNESGTLQSKPAYKKENG 133
           A+     G R G D +GVR  A Y T+ E G L  +P   + +G
Sbjct: 38  ATRAMMHGTRLGVDSHGVRLLAHYVTALEGGRLNRRPQISRVSG 81


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.124    0.362 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 25,031,198
Number of Sequences: 62578
Number of extensions: 997733
Number of successful extensions: 1409
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1406
Number of HSP's gapped (non-prelim): 10
length of query: 869
length of database: 14,973,337
effective HSP length: 107
effective length of query: 762
effective length of database: 8,277,491
effective search space: 6307448142
effective search space used: 6307448142
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 56 (26.2 bits)