Citrus Sinensis ID: 002911


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------
MEKSCTLLIHFDKGTPAIANEIKEALEGNDVPAKVDAMKKAIMLLLNGETLPQLFITIVRYVLPSEDHTIQKLLLLYLEIIDKTDAKGRVLPEMILICQNLRNNLQHPNEYIRGVTLRFLCRLNETEIIEPLIPSVLQNLQHRHPYIRRNAILAVMAIYKLPQGEQLLVDAPEMIEKVLSTEQDPSAKRNAFLMLFTCDQDRAINYLLTHVDRVSEWGELLQMVVLELIRKVCRTNKGEKGKYIKIIISLLNAPSTAVIYECAGTLVSLSSAPTAIRAAANTYSQLLLSQSDNNVKLIVLDRLNELRSSHRDIMVDLIMDVLRALNSPNLDIRRKTLDIVLELITPRNINEVVLMLKKEVVKTQSGELEKNGEYRQMLIQAIHSCAIKFPEVASTVVHLLMDFLGDSNVASAIDVIIFVREIIEMNPKLRVSIITRLLDNFYQIRAARVCTCALWIIGEYCQSLSEVENGIATIKQCLGELPFFSVSEEGEDTDSSKKVQQQASSTTVSSRRPAVLADGTYATQSAASETAFSPPTIVQGTLTSGNLRSLLLTGDFFLGAVVACTLTKLVLRLEEVQPSRVEVNKASSQALLIMVSMLQLGQSPVLPHPIDNDSFDRIVVCIRLLCNTGDNIRKIWLQSCRQSFVKMLSEKQLRESEELKAKAQISHAQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFVKEGDDANKLNRILQLTGFSDPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIKVSSTETGVIFGNIVYETSNVLERTVVVLNDIHIDIMDYISPAVCTDAAFRTMWAEFEWENKVSLALVSCFFHTNH
cccccEEEEEccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHEEccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHcccccccccccccEEEEEEEEEEEEEEEEEEEEEEccccccccEEEEEEEccccEEcccccccccccccCEEEEEEEEEEEccccEEEEEEEEcccccccccEEEccccccccccccccccccHHHHHHHcccccccEEEEEccccccccccc
**KSCTLLIHFDKGTPAIANEIKEALEGNDVPAKVDAMKKAIMLLLNGETLPQLFITIVRYVLPSEDHTIQKLLLLYLEIIDKTDAKGRVLPEMILICQNLRNNLQHPNEYIRGVTLRFLCRLNETEIIEPLIPSVLQNLQHRHPYIRRNAILAVMAIYKLPQGEQLLVDAPEMIEKVLSTEQDPSAKRNAFLMLFTCDQDRAINYLLTHVDRVSEWGELLQMVVLELIRKVCRTNKGEKGKYIKIIISLLNAPSTAVIYECAGTLVSLSSAPTAIRAAANTYSQLLLSQSDNNVKLIVLDRLNELRSSHRDIMVDLIMDVLRALNSPNLDIRRKTLDIVLELITPRNINEVVLMLKKEVVKTQSGELEKNGEYRQMLIQAIHSCAIKFPEVASTVVHLLMDFLGDSNVASAIDVIIFVREIIEMNPKLRVSIITRLLDNFYQIRAARVCTCALWIIGEYCQSLSEVENGIATIKQCLGELPFFS*******************************ADGTYATQSAASE*************TSGNLRSLLLTGDFFLGAVVACTLTKLVLRLEEVQPSRVEVNKASSQALLIMVSMLQLGQSPVLPHPIDNDSFDRIVVCIRLLCNTGDNIRKIWLQSCRQSFVKML**********************DDLIDFYHLKS**********DEVQDDLK************ANKLNRILQLTGFSDPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIKVSSTETGVIFGNIVYETSNVLERTVVVLNDIHIDIMDYISPAVCTDAAFRTMWAEFEWENKVSLALVSCFF*T**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKSCTLLIHFDKGTPAIANEIKEALEGNDVPAKVDAMKKAIMLLLNGETLPQLFITIVRYVLPSEDHTIQKLLLLYLEIIDKTDAKGRVLPEMILICQNLRNNLQHPNEYIRGVTLRFLCRLNETEIIEPLIPSVLQNLQHRHPYIRRNAILAVMAIYKLPQGEQLLVDAPEMIEKVLSTEQDPSAKRNAFLMLFTCDQDRAINYLLTHVDRVSEWGELLQMVVLELIRKVCRTNKGEKGKYIKIIISLLNAPSTAVIYECAGTLVSLSSAPTAIRAAANTYSQLLLSQSDNNVKLIVLDRLNELRSSHRDIMVDLIMDVLRALNSPNLDIRRKTLDIVLELITPRNINEVVLMLKKEVVKTQSGELEKNGEYRQMLIQAIHSCAIKFPEVASTVVHLLMDFLGDSNVASAIDVIIFVREIIEMNPKLRVSIITRLLDNFYQIRAARVCTCALWIIGEYCQSLSEVENGIATIKQCLGELPFFSVSEEGEDTDSSKKVQQQASSTTVSSRRPAVLADGTYATQSAASETAFSPPTIVQGTLTSGNLRSLLLTGDFFLGAVVACTLTKLVLRLEEVQPSRVEVNKASSQALLIMVSMLQLGQSPVLPHPIDNDSFDRIVVCIRLLCNTGDNIRKIWLQSCRQSFVKMLSEKQLRESEELKAKAQISHAQPDDLIDFYHLKSRKGMSQLELEDEVQDDLKRATGEFVKEGDDANKLNRILQLTGFSDPVYAEAYVTVHHYDIVLDVTVINRTKETLQNLCLELATMGDLKLVERPQNYTLAPESSKQIKANIKVSSTETGVIFGNIVYETSNVLERTVVVLNDIHIDIMDYISPAVCTDAAFRTMWAEFEWENKVSLALVSCFFHTNH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit beta-1 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ9SV21
Coatomer subunit beta-2 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ9SV20
Coatomer subunit beta-1 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ53PC7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain B
Confidence level:very confident
Coverage over the Query: 14-474
View the alignment between query and template
View the model in PyMOL
Template: 2Z6H, chain A
Confidence level:confident
Coverage over the Query: 16-481
View the alignment between query and template
View the model in PyMOL
Template: 1R4X, chain A
Confidence level:confident
Coverage over the Query: 718-848
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 630-711
View the alignment between query and template
View the model in PyMOL