Citrus Sinensis ID: 002930


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860----
MSSWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSSDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDFLEDLWHRVQALSSNGWKLDSVPRPHLSFEAQLVSGKSHEFGPISCPEQPDVPTAVSGITHGKQKHDAELKYPQRIRRLNIFPASKSEVDMQPIDRFILEEYLLDVLLFFNGCRKECAFYMVNLPVPFRYEYLMAETIFSQLLLLPQPPFKPIYYTLVIMDLCKALPGAFPAVVAGAVRALFDKIADLDMECRIRFILWFSHHLSNFQFIWPWEEWAYVLDLPKWAPQRVFVQEVLEREVRLSYWDKVKQSIENAPALEELLPPKGGPNFKYSMEDGRERSEEHALSAELTNKVKGRQTAREIIVWVEESVYPIHGLGVTIKVVVQTLLDIGSKSFTHLITVLERYGQVISKICPDHDKQLMLIEEVSLFWKNNTQNAAISIDRMMGYRLISNLAIVRWVFSPENIDQFHASDRPWEVLRNAVSKTYNRICDLRKEIISLKKGVTLAEEAAAKAKAELEAAESKLSLVDGEPVLGGNPARLSRLKLHAEKAKNEEISAKESLEAKEALFARAVEENEALYLSLYRNFSNVLMERLPDASRAGTLQDLKSTHADAMAVDLEEPSAMELDNENGRPKKSQSNGGSSGNVYNIGEKEQWCLSTLGYVKAFSRQYASEIWPHMEKLDAEVLSEDTHPLFRRAVYSGLHRPIN
ccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHHHHHcccccHHHccccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccc
**SWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSSDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDFLEDLWHRVQALSSNGWKLDSVPRPHLSFEAQLVSGKSHEFGPISCPEQPD************QKHDAELKYPQRIRRLNIFPASKSEVDMQPIDRFILEEYLLDVLLFFNGCRKECAFYMVNLPVPFRYEYLMAETIFSQLLLLPQPPFKPIYYTLVIMDLCKALPGAFPAVVAGAVRALFDKIADLDMECRIRFILWFSHHLSNFQFIWPWEEWAYVLDLPKWAPQRVFVQEVLEREVRLSYWDKVKQSIENAPALEELLPPKGGPNFKYSMEDGRERSEEHALSAELTNKVKGRQTAREIIVWVEESVYPIHGLGVTIKVVVQTLLDIGSKSFTHLITVLERYGQVISKICPDHDKQLMLIEEVSLFWKNNTQNAAISIDRMMGYRLISNLAIVRWVFSPENIDQFHASDRPWEVLRNAVSKTYNRICDLRKEIISLKKGVTLA**************************************************AKESLEAKEALFARAVEENEALYLSLYRNFSNVLMER****************************************************VYNIGEKEQWCLSTLGYVKAFSRQYASEIWPHMEKLDAEVLSEDTHPLFRRAVYSGLHRP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSWKNLLLKIGDNCPEYGNSDDLKDHIETCFGVIRRELEHSSDDVPHYIINCAEQIPHKIPLYGTLVGLLNLENEDFVKKVVETTQRKFQDALDSGNCDRIRILMRFLTVMMCSKILQPGSLVVVFETLLSSAATTVDEDKGNPSWQARADFYVTCILSCLPWGGAELIEQVPEEIERVMAGLEAYLSIRRHTSDTGLSFFEEDDESGKGLVEKDFLEDLWHRVQALSSNGWKLDSVPRPHLSFEAQLVSGKSHEFGPISCPEQPDVPTAVSGITHGKQKHDAELKYPQRIRRLNIFPASKSEVDMQPIDRFILEEYLLDVLLFFNGCRKECAFYMVNLPVPFRYEYLMAETIFSQLLLLPQPPFKPIYYTLVIMDLCKALPGAFPAVVAGAVRALFDKIADLDMECRIRFILWFSHHLSNFQFIWPWEEWAYVLDLPKWAPQRVFVQEVLEREVRLSYWDKVKQSIENAPALEELLPPKGGPNFKYSMEDGRERSEEHALSAELTNKVKGRQTAREIIVWVEESVYPIHGLGVTIKVVVQTLLDIGSKSFTHLITVLERYGQVISKICPDHDKQLMLIEEVSLFWKNNTQNAAISIDRMMGYRLISNLAIVRWVFSPENIDQFHASDRPWEVLRNAVSKTYNRICDLRKEIISLKKGxxxxxxxxxxxxxxxxxxxxxxxxxxxxPVLGGNPARLSRLKLHxxxxxxxxxxxxxxxxxxxxxFARAVEENEALYLSLYRNFSNVLMERLPDASRAGTLQDLKSTHADAMAVDLEEPSAMELDNENGRPKKSQSNGGSSGNVYNIGEKEQWCLSTLGYVKAFSRQYASEIWPHMEKLDAEVLSEDTHPLFRRAVYSGLHRPIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear cap-binding protein subunit 1 Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary miRNA processing. In the CBC complex, ABH1/CBP80 does not bind directly capped RNAs (m7GpppG-capped RNA) but is required to stabilize the movement of the N-terminal loop of CBP20 and lock the CBC into a high affinity cap-binding state with the cap structure. Involved in flowering regulation, possibly by regulating pre-mRNA splicing of FLC gene. Acts as a negative regulator of abscisic acid signaling in guard cells.probableQ9SIU2
Nuclear cap-binding protein subunit 1 Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi) by microRNAs (miRNAs). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary miRNA processing. In the CBC complex, ABH1/CBP80 does not bind directly capped RNAs (m7GpppG-capped RNA) but is required to stabilize the movement of the N-terminal loop of CBP20 and lock the CBC into a high affinity cap-binding state with the cap structure.probableQ10LJ0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H2V, chain C
Confidence level:very confident
Coverage over the Query: 2-264,282-652,713-760,808-861
View the alignment between query and template
View the model in PyMOL