Citrus Sinensis ID: 002999


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------86
MDLARALGIESDNHNELTEQIKQLKSDLSQSSSVSERRILTSLQRILDTWSVVPDVAALNWDSELEEDCHILPFKNFLCPLTKQVMKEPVVLESAQAYERKAIEYWFERCLEDGRDPTCPVTGQVLKSLELKPNIGLAGAIEEWVNRNVEVQVSTVVETLRKENPEVDGLDKALDIVFKISEEHPSNRYRVRNAGVVLLIVKLLKSSSKSVGTILRSKALMALLSMAKDEESKKIMLEEGVTKSVIHSLIGNSEKEKEYAVKLLLEFCIDEAYCKSVASEKGALVLLSSMTGNLELPALSNLADEVFKKMERIEEIVQPLAAAGRFEPLINRLCQGSDNVQIEMAFLVGKLTLTNSCKEHIARQCAKVLVELLSKPAGRAASLKALYNLSGLDDNATILVDSALLPALTDILFKSHDASPELKELAAATIANVVSNPGCWELASADKLGHSMQSESIVSSLLGLLSGVSPQCQVSTLRILCGIASSPQAAESVATHIKSGDGIKYIIQFLEHPEVEHRTYAFRLTRILSERIGQDLAYALKPFDKLVLFKDKILDNQSANCERSDAACILANIQLSEEEVKTLLEATFIKWIVITLQTHKSSFNTRSSRPISNIAEGLLGLLLHFTRSVNPQTLGMVREQRLMTIFRDQLSFPSKARVKQLAAHGLKNLSEAGRSLCAEDTGSPTPRRFCASLVFICGKPPPEPTTCPIHNTPCEDDSQLCLLKSNCIKPLVDLLAEEDTNVEIAAVEALSTLIIDTSKNFKRGVDELEREGALDAVVDLFTEVRPGLLQERTVWMLERVLRVEGHSHRYSLNQSLVRALVEAFKHGNANAKRHAQEALTNLKQISGLSGKASQPRARR
cHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHcccccccccccccccccccccccccccccHHHHHccccHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccHHHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccc
***ARALGIESDN*************************ILTSLQRILDTW*******************HILPFKNFLCPLTKQVMKEPVVLESAQAYERKAIEYWFERCLEDGRDPTCPVTGQVLKSLELKPNIGLAGAIEEWVNRNVEVQVSTVVETL****PEVDGLDKALDIVFKISEEHPSNRYRVRNAGVVLLIVKLLKSSSKSVGTILRSKALMALLSMAKDEESKKIMLEEGVTKSVIHSLIGNSEKEKEYAVKLLLEFCIDEAYCKSVASEKGALVLLSSMTGNLELPALSNLADEVFKKMERIEEIVQPLAAAGRFEPLINRLCQGSDNVQIEMAFLVGKLTLTNSCKEHIARQCAKVLVELLSKPAGRAASLKALYNLSGLDDNATILVDSALLPALTDILFKSHDASPELKELAAATIANVVSNPGCWELASADKLGHSMQSESIVSSLLGLLSGVSPQCQVSTLRILCGIASSPQAAESVATHIKSGDGIKYIIQFLEHPEVEHRTYAFRLTRILSERIGQDLAYALKPFDKLVLFKDKILDNQSANCERSDAACILANIQLSEEEVKTLLEATFIKWIVITLQTHKSSF******PISNIAEGLLGLLLHFTRSVNPQTLGMVREQRLMTIFRDQLSFPSKARVKQLAAHGLKNLSEA**************RRFCASLVFICGKP****TTCPIHNTPCEDDSQLCLLKSNCIKPLVDLLAEEDTNVEIAAVEALSTLIIDTSKNFKRGVDELEREGALDAVVDLFTEVRPGLLQERTVWMLERVLRVEGHSHRYSLNQSLVRALVEAFKHGN**AKRHAQEALTNLK****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLARAxxxxxxxxxxxxxxxxxxxxxxxxxxxxSERRILTSLQRILDTWSVVPDVAALNWDSELEEDCHILPFKNFLCPLTKQVMKEPVVLESAQAYERKAIEYWFERCLEDGRDPTCPVTGQVLKSLELKPNIGLAGAIEEWVNRNVEVQVSTVVETLRKENPEVDGLDKALDIVFKISEEHPSNRYRVRNAGVVLLIVKLLKSSSKSVGTILRSKALMALLSMAKDEESKKIMLEEGVTKSVIHSLIGNSEKEKEYAVKLLLEFCIDEAYCKSVASEKGALVLLSSMTGNLELPALSNLADEVFKKMERIEEIVQPLAAAGRFEPLINRLCQGSDNVQIEMAFLVGKLTLTNSCKEHIARQCAKVLVELLSKPAGRAASLKALYNLSGLDDNATILVDSALLPALTDILFKSHDASPELKELAAATIANVVSNPGCWELASADKLGHSMQSESIVSSLLGLLSGVSPQCQVSTLRILCGIASSPQAAESVATHIKSGDGIKYIIQFLEHPEVEHRTYAFRLTRILSERIGQDLAYALKPFDKLVLFKDKILDNQSANCERSDAACILANIQLSEEEVKTLLEATFIKWIVITLQTHKSSFNTRSSRPISNIAEGLLGLLLHFTRSVNPQTLGMVREQRLMTIFRDQLSFPSKARVKQLAAHGLKNLSEAGRSLCAEDTGSPTPRRFCASLVFICGKPPPEPTTCPIHNTPCEDDSQLCLLKSNCIKPLVDLLAEEDTNVEIAAVEALSTLIIDTSKNFKRGVDELEREGALDAVVDLFTEVRPGLLQERTVWMLERVLRVEGHSHRYSLNQSLVRALVEAFKHGNANAKRHAQEALTNLKQISGLSGKASQPRARR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U-box domain-containing protein 43 Functions as an E3 ubiquitin ligase.probableQ9SFX2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DB6, chain A
Confidence level:very confident
Coverage over the Query: 196-391
View the alignment between query and template
View the model in PyMOL
Template: 4DB6, chain A
Confidence level:very confident
Coverage over the Query: 241-435
View the alignment between query and template
View the model in PyMOL
Template: 3NMZ, chain A
Confidence level:very confident
Coverage over the Query: 164-532
View the alignment between query and template
View the model in PyMOL
Template: 3NMZ, chain A
Confidence level:very confident
Coverage over the Query: 208-577
View the alignment between query and template
View the model in PyMOL
Template: 1JDH, chain A
Confidence level:very confident
Coverage over the Query: 195-441,453-601,613-614,626,649-673,717-800
View the alignment between query and template
View the model in PyMOL
Template: 1JDH, chain A
Confidence level:very confident
Coverage over the Query: 240-579,630-676,720-843
View the alignment between query and template
View the model in PyMOL
Template: 1T1H, chain A
Confidence level:very confident
Coverage over the Query: 73-149
View the alignment between query and template
View the model in PyMOL
Template: 3M62, chain A
Confidence level:confident
Coverage over the Query: 13-149
View the alignment between query and template
View the model in PyMOL
Template: 1QGR, chain A
Confidence level:confident
Coverage over the Query: 132-439,451-676,720-844
View the alignment between query and template
View the model in PyMOL
Template: 1HO8, chain A
Confidence level:probable
Coverage over the Query: 461-600,628-666,677-699,717-802
View the alignment between query and template
View the model in PyMOL
Template: 3OQS, chain A
Confidence level:probable
Coverage over the Query: 149-524
View the alignment between query and template
View the model in PyMOL