Citrus Sinensis ID: 003009


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------86
MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMLQLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIENNNGNQLDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVTQEQLNSNSVNFQVCPSNGSHLRDASGSPIADDEGNKPENS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHccccEEEEEEccccccEEEEEEccHHHHHHHHHHHcccccccCEEEEEEccccccccccccccCEEEEEcccccccHHHHHHHHHccccEEEcccccccccEEEEEEccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHccccHHHHHHHHHHHHHcccccccEEEEccccccccccEEEEEEccccccHHHHHHHHccccccccccccEEEEEEHHHHHHHHHHHHHccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccc
***************************************SDDASLFSSSLPVLPHEKLNL************************************AIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQES*******************LHYSV******************RTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHF*************QGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSR****************************************************************************************************************************************************************************************************************************************FMNPVAFCGMGIGQNDGSFMVN**********************************VFLGNGPYPGLT***I***************************LELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSE*************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQFFDHSSGPPKIPQLNIPKEVGGGSCGRIAGSDSYLASDDASLFSSSLPVLPHEKLNLNAMGLGRQSVDDISSGLSKVHHGVASDDPLEGVMNPAIGNSLPDDEDELLAGIMDDFDLRGLPSSLEDLEDYDIFGSGGGMELEGEPQESLSMSMSKISISDSASGNGLLHYSVPNGAGTVAGEHPYGEHPSRTLFVRNINSNVEDSELRALFEQYGDIRTLYTACKHRGFVMISYYDIRAARTAMRALQNKPLRRRKLDIHFSIPKDNPSDKDLNQGTLVVFNLDPSVSNEDLRQIFGAYGEVKEIRETPHKRHHKFIEFYDVRAAEAALKSLNRSDIAGKRIKLEPSRPGGARRNLMLQLNQELEQDESRILQHQVGSPITNSPPGNWVQFSSPIEHNPLQTISKSPNFRNMSPTTSNHMPGLASILHPQVSTLEKIAPIGKDQGRGSLMEHALTNTISANGASFQQSNSFSEPKIGLYRGTVSSFGPSPSNGSGVETLSGPQFLWGSPSRYSEHSSSPAWQTSSMGHPFSSNGKIHGLPYSGRQGSFLGSSQHHHVGSAPSGVPLERRFGFLPESPETSFMNPVAFCGMGIGQNDGSFMVNMGSRASVNPGITVPRNLSDNGSSFRVMSSPRLSPVFLGNGPYPGLTPANIEGLYERGRSRRIENNNGNQLDSKKQFQLELEKIRSGEDTRTTLMIKNIPNKYTSKMLLAAIDENHKGTYDFLYLPIDFKNKCNVGYAFINMLSPLHIIPFYEAFNGKKWEKFNSEKVASLAYARIQGRAALVAHFQNSSLMNEDKRCRPILFHSEGPEAGDQVTQEQLNSNSVNFQVCPSNGSHLRDASGSPIADDEGNKPENS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein MEI2-like 2 Probable RNA-binding protein that may play a role in growth regulation.probableQ6ZI17
Protein MEI2-like 5 Probable RNA-binding protein that plays a role in meiosis and vegetative growth.probableQ8VWF5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 188-270
View the alignment between query and template
View the model in PyMOL
Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 114-360
View the alignment between query and template
View the model in PyMOL
Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 193-264,276-379
View the alignment between query and template
View the model in PyMOL
Template: 1UW4, chain A
Confidence level:probable
Coverage over the Query: 695-780
View the alignment between query and template
View the model in PyMOL