BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 003017
(857 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2DFK|A Chain A, Crystal Structure Of The Cdc42-Collybistin Ii Complex
pdb|2DFK|C Chain C, Crystal Structure Of The Cdc42-Collybistin Ii Complex
Length = 402
Score = 30.8 bits (68), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 15/50 (30%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
Query: 330 IAHLKEVAEGEIQEIKSERDQLEKEKHEVKV-NREKLQEQQLGMRKDIDE 378
I HLK++ EG +++ + RD E+ +V N E + Q+G +D+++
Sbjct: 57 IKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEK 106
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.309 0.126 0.336
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,724,115
Number of Sequences: 62578
Number of extensions: 761018
Number of successful extensions: 2551
Number of sequences better than 100.0: 117
Number of HSP's better than 100.0 without gapping: 25
Number of HSP's successfully gapped in prelim test: 92
Number of HSP's that attempted gapping in prelim test: 2314
Number of HSP's gapped (non-prelim): 262
length of query: 857
length of database: 14,973,337
effective HSP length: 107
effective length of query: 750
effective length of database: 8,277,491
effective search space: 6208118250
effective search space used: 6208118250
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 56 (26.2 bits)