Citrus Sinensis ID: 003066


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-
MAKIPFLCFHLLALLCFILVSVFPPSLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSLSGEISSSISALQSLTVLSLPFNVLSGKLPLELSNCSNLKVLNVTGNAMVGSVPDLSALKNLEIFDLSINYFTGRFPRWVVNLTQLVSLSIGDNVYDEAEIPESIGNLKNLTYLFLAHCNLRGRIPESISELRELGTLDICRNKISGEFPRSIRKLQKLWKIELYANNLTGELPAELGNLTLLQEFDISSNQMYGKLPEEIGNLKNLTVFQCFKNNFSGEFPSGFGDMRKLFAFSIYGNRFSGPFPENLGRYTALTDVDISENQFSGSFPKYLCEKRKLLNLLALSNNFSGEVPNSYADCKTIQRLRISDNHLSGKIPDGLWALPNVGMLDFGDNDFTGGISPLIGLSTSLSQLVLQNNRFSGELPSELGRLTNLERLILTNNNFSGKIPSALGALRQLSSLHLEENALTGSIPNEMGDCARIVDLNLARNSLSGNIPRSLSLLSSLNALNLSGNKLTGSIPDNLMKLKLSSIDLSENQLSGSVPLDFLRMGGDGAFAGNEGLCLDQSTKMLMNSKLTACPAIQKQKGGFKDKLVLFCIIAVALAAFLAGLLLVSYKNFKLSADMENGEKEVSSKWKLASFHHIDIDAEQICNLEEDNLIGSGGTGKVYRLDLKKNAGTVAVKQLWKGDGVKVFAAEMEILGKIRHRNILKLYACLLKGGSSFLVLEYMPNGNLFQALHKRVKEGKPELDWFRRYKIALGAAKGIAYLHHDCSPPIIHRDIKSSNILLDEDYEPKIADFGVAKIAENSPKVSDYSCFAGTHGYIAPG
cccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccccccccccccEEcccccccEEEEEccccccCEEccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccEEEEccccccccccHHccccccccEEEccccccccccccHHHcccccccEEcccccccEEcccHHHHccccccEEEccccccccccccccccccccccEEcccccccccccccccccccccEEcccccccCCcccHHHHccccccEEEcccccccccccHHHccccccccEEcccccccccccccccccccccEEEccccCEECcccHHHHcccccccccccccCEEECccccccccccccEEEcccccccccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHcccccccEEcccccccccccHHHcccccccccccccccccccccHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccEEEccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccCECcccHHHHHHHccccccEEEcccccEEEEEEEcccccEEEEEEcccccccccHHHHHHHHccccccccccEEEEEEccccEEEEEcccccccHHHHHccccccccccccHHHHHHHHHHHHHHccccccccccccCECccccccccccccccEEEccccccccccccccccccccccccccccccc
*AKIPFLCFHLLALLCFILVSVFPPSLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSLSGEISSSISALQSLTVLSLPFNVLSGKLPLELSNCSNLKVLNVTGNAMVGSVPDLSALKNLEIFDLSINYFTGRFPRWVVNLTQLVSLSIGDNVYDEAEIPESIGNLKNLTYLFLAHCNLRGRIPESISELRELGTLDICRNKISGEFPRSIRKLQKLWKIELYANNLTGELPAELGNLTLLQEFDISSNQMYGKLPEEIGNLKNLTVFQCFKNNFSGEFPSGFGDMRKLFAFSIYGNRFSGPFPENLGRYTALTDVDISENQFSGSFPKYLCEKRKLLNLLALSNNFSGEVPNSYADCKTIQRLRISDNHLSGKIPDGLWALPNVGMLDFGDNDFTGGISPLIGLSTSLSQLVLQNNRFSGELPSELGRLTNLERLILTNNNFSGKIPSALGALRQLSSLHLEENALTGSIPNEMGDCARIVDLNLARNSLSGNIPRSLSLLSSLNALNLSGNKLTGSIPDNLMKLKLSSIDLSENQLSGSVPLDFLRMGGDGAFAGNEGLCLDQSTKMLM**************GGFKDKLVLFCIIAVALAAFLAGLLLVSYKNFKL*************KWKLASFHHIDIDAEQICNLEEDNLIGSGGTGKVYRLDLKKNAGTVAVKQLWKGDGVKVFAAEMEILGKIRHRNILKLYACLLKGGSSFLVLEYMPNGNLFQALHKRVKEGKPELDWFRRYKIALGAAKGIAYLHHDCSPPIIHRDIKSSNILLDEDYEPKIADFGVAKIAENSPKVSDYSCFAGTHGYIAPG
xxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKIPFLCFHLLALLCFILVSVFPPSLSLNVETQALIQFKSKLKDPHGVLDSWKESADSPCGFSGITCDSVTGRVTEISFDNKSLSGEISSSISALQSLTVLSLPFNVLSGKLPLELSNCSNLKVLNVTGNAMVGSVPDLSALKNLEIFDLSINYFTGRFPRWVVNLTQLVSLSIGDNVYDEAEIPESIGNLKNLTYLFLAHCNLRGRIPESISELRELGTLDICRNKISGEFPRSIRKLQKLWKIELYANNLTGELPAELGNLTLLQEFDISSNQMYGKLPEEIGNLKNLTVFQCFKNNFSGEFPSGFGDMRKLFAFSIYGNRFSGPFPENLGRYTALTDVDISENQFSGSFPKYLCEKRKLLNLLALSNNFSGEVPNSYADCKTIQRLRISDNHLSGKIPDGLWALPNVGMLDFGDNDFTGGISPLIGLSTSLSQLVLQNNRFSGELPSELGRLTNLERLILTNNNFSGKIPSALGALRQLSSLHLEENALTGSIPNEMGDCARIVDLNLARNSLSGNIPRSLSLLSSLNALNLSGNKLTGSIPDNLMKLKLSSIDLSENQLSGSVPLDFLRMGGDGAFAGNEGLCLDQSTKMLMNSKLTACPAIQKQKGGFKDKLVLFCIIAVALAAFLAGLLLVSYKNFKLSADMENGEKEVSSKWKLASFHHIDIDAEQICNLEEDNLIGSGGTGKVYRLDLKKNAGTVAVKQLWKGDGVKVFAAEMEILGKIRHRNILKLYACLLKGGSSFLVLEYMPNGNLFQALHKRVKEGKPELDWFRRYKIALGAAKGIAYLHHDCSPPIIHRDIKSSNILLDEDYEPKIADFGVAKIAENSPKVSDYSCFAGTHGYIAPG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 27-324
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 289-351,376-564
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 74-573
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 27-592
View the alignment between query and template
View the model in PyMOL
Template: 3UIM, chain A
Confidence level:very confident
Coverage over the Query: 676-851
View the alignment between query and template
View the model in PyMOL
Template: 2J4Z, chain A
Confidence level:probable
Coverage over the Query: 668-850
View the alignment between query and template
View the model in PyMOL