BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003089
         (849 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2A3Q|A Chain A, X-Ray Structure Of Protein From Mus Musculus Mm.29898
 pdb|2A3Q|B Chain B, X-Ray Structure Of Protein From Mus Musculus Mm.29898
 pdb|2Q4P|A Chain A, Ensemble Refinement Of The Crystal Structure Of Protein
           From Mus Musculus Mm.29898
 pdb|2Q4P|B Chain B, Ensemble Refinement Of The Crystal Structure Of Protein
           From Mus Musculus Mm.29898
          Length = 170

 Score = 29.3 bits (64), Expect = 9.3,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 11/69 (15%)

Query: 53  TGGDSE-----DEDNGEQRLIRTGPRIDSFDVEALEVPGALRNDYEEFSVGRKIILAFQT 107
           T GD E      ED+   R  R  P     D+  L    A   D+E+F   R ++LA   
Sbjct: 3   TAGDGERGTVGQEDSAAARPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLA--- 59

Query: 108 LGVVFGDVG 116
              + G+VG
Sbjct: 60  ---LVGEVG 65


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.138    0.410 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,538,098
Number of Sequences: 62578
Number of extensions: 673414
Number of successful extensions: 1104
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1104
Number of HSP's gapped (non-prelim): 1
length of query: 849
length of database: 14,973,337
effective HSP length: 107
effective length of query: 742
effective length of database: 8,277,491
effective search space: 6141898322
effective search space used: 6141898322
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (26.2 bits)