BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 003089
(849 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2A3Q|A Chain A, X-Ray Structure Of Protein From Mus Musculus Mm.29898
pdb|2A3Q|B Chain B, X-Ray Structure Of Protein From Mus Musculus Mm.29898
pdb|2Q4P|A Chain A, Ensemble Refinement Of The Crystal Structure Of Protein
From Mus Musculus Mm.29898
pdb|2Q4P|B Chain B, Ensemble Refinement Of The Crystal Structure Of Protein
From Mus Musculus Mm.29898
Length = 170
Score = 29.3 bits (64), Expect = 9.3, Method: Composition-based stats.
Identities = 21/69 (30%), Positives = 29/69 (42%), Gaps = 11/69 (15%)
Query: 53 TGGDSE-----DEDNGEQRLIRTGPRIDSFDVEALEVPGALRNDYEEFSVGRKIILAFQT 107
T GD E ED+ R R P D+ L A D+E+F R ++LA
Sbjct: 3 TAGDGERGTVGQEDSAAARPFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLA--- 59
Query: 108 LGVVFGDVG 116
+ G+VG
Sbjct: 60 ---LVGEVG 65
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.138 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,538,098
Number of Sequences: 62578
Number of extensions: 673414
Number of successful extensions: 1104
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1104
Number of HSP's gapped (non-prelim): 1
length of query: 849
length of database: 14,973,337
effective HSP length: 107
effective length of query: 742
effective length of database: 8,277,491
effective search space: 6141898322
effective search space used: 6141898322
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (26.2 bits)