BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003109
         (847 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker
          Length = 437

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 11/61 (18%)

Query: 672 PNLAGPGGITPLHLAACTSDSDDIIDALTNDPQEIGPSS--WNSILDASGHSPYSYALMK 729
           PN AG  G+TPLH+ A   ++ DI+  L   P+   P S  WN      G++P   A  +
Sbjct: 172 PNAAGKNGLTPLHV-AVHHNNLDIVKLLL--PRGGSPHSPAWN------GYTPLHIAAKQ 222

Query: 730 N 730
           N
Sbjct: 223 N 223


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.390 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 23,964,970
Number of Sequences: 62578
Number of extensions: 937188
Number of successful extensions: 2059
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 2055
Number of HSP's gapped (non-prelim): 5
length of query: 847
length of database: 14,973,337
effective HSP length: 107
effective length of query: 740
effective length of database: 8,277,491
effective search space: 6125343340
effective search space used: 6125343340
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)