Citrus Sinensis ID: 003215


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------84
MLEKEDDLGNPRGSCQLPGSRKMFWRSASWSSSRTASQNPETEERDLVDPSGSNIVNSNGRRFPVPLTPRSQQNSKARSCLPPLQPLSIARRSLDEWPKASSDDVGEWHQPPTPSGNKSGERLKLDLSSIQRNSDKNGGLVKRDKIAFFDKECSKVAEHIYLGGDAVARDRDILKQHGITHILNCVGFVCPEYFKADFVYRTLWLQDSPSEDITSILYDVFDYFEDVREKGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFDDAFQYVKAARGIADPNMGFACQLLQCQKRVHAFPLSPSSLLRMYRIAPHSPYDPLHLVPKMLNDPTPSALDSRGAFIVHIPAAIYIWIGKHCESIMERDARGAVCQLVRYERAQGRIVIIKEGEEPGYFWDAFSNFLPLMDKSRNGVEIRESTIKMVPGERKVNSYDVDYEIFRKAIMGGFVPPFSSSENEHETHLPARESSWSALRRKFASGDMKEFVSVPKISLCRVYSESMMLVHSSSPSSSTSSLLSSSSSPPYLSPDSVCSDSSTSSKCSSESSMDSPSAASCSLPVSSTLSNFSNLSLRSFKNSSEDIPNKPETCGSQPPLSPVKRISPSLAERRGSLSKSLKLPVMTSNVRANSSLDLLASQEDVASRSDNTYTLCNSDSIDIVFKSKSAIRNGEEDATQMCKLKISPSSVDTAELCHKVSSSANNCVDSGRNYSWREGLKANRLDESVPDHCNQMQPLIYRWPTFERVGKFDSSALNSKSAFAIFSPSRDSGKSAARVLYFWVGRSFCHGKSRIQLDNNKELGNIEGSDQNQFGYDILTRMGLPKDTPIKIVKEDEEPREFLALLSTP
cccccccccccccccccccccccEEEEcccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHccccccEEEccEEEccHHHHccHHHHHHccccEEEEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccHHHHHcccccccccccccccccccccccccccccccEEEEEcccEEEEEcccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEccEECcccccccccccccccccccccHHHHHHHHHHHccccccccEEEEcccccHHHHHHHcccc
*******************************************************************************************************************************************LVKRDKIAFFDKECSKVAEHIYLGGDAVARDRDILKQHGITHILNCVGFVCPEYFKADFVYRTLWLQDSPSEDITSILYDVFDYFEDVREKGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFDDAFQYVKAARGIADPNMGFACQLLQCQKRVHAF*****SLLR****A*HSPYDPLHLVPKML******ALDSRGAFIVHIPAAIYIWIGKHCESIMERDARGAVCQLVRYERAQGRIVIIKEGEEPGYFWDAFSNFLPLMDKSRNGVEIRESTIKMVPGERKVNSYDVDYEIFRKAIMGGFVP******************SWSALRRKFASGDMKEFVSVPKISLCRVYSE**************************************************************************************************************************************************TYTLCNSDSIDIVFK****************************************CVDSGRNYSWREGLKANRLDESVPDHCNQMQPLIYRWPTFERVGKFDSSALNSKSAFAIFSPSRDSGKSAARVLYFWVGRSFCHGKSRIQLDNN**LGNIEGSDQNQFGYDILTRMGLPKDTPIKIVKEDEEPREFLALLS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLEKEDDLGNPRGSCQLPGSRKMFWRSASWSSSRTASQNPETEERDLVDPSGSNIVNSNGRRFPVPLTPRSQQNSKARSCLPPLQPLSIARRSLDEWPKASSDDVGEWHQPPTPSGNKSGERLKLDLSSIQRNSDKNGGLVKRDKIAFFDKECSKVAEHIYLGGDAVARDRDILKQHGITHILNCVGFVCPEYFKADFVYRTLWLQDSPSEDITSILYDVFDYFEDVREKGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFDDAFQYVKAARGIADPNMGFACQLLQCQKRVHAFPLSPSSLLRMYRIAPHSPYDPLHLVPKMLNDPTPSALDSRGAFIVHIPAAIYIWIGKHCESIMERDARGAVCQLVRYERAQGRIVIIKEGEEPGYFWDAFSNFLPLMDKSRNGVEIRESTIKMVPGERKVNSYDVDYEIFRKAIMGGFVPPFSSSENEHETHLPARESSWSALRRKFASGDMKEFVSVPKISLCRVYSESMMLVHSSSPSSSTSSLLSSSSSPPYLSPDSVCSDSSTSSKCSSESSMDSPSAASCSLPVSSTLSNFSNLSLRSFKNSSEDIPNKPETCGSQPPLSPVKRISPSLAERRGSLSKSLKLPVMTSNVRANSSLDLLASQEDVASRSDNTYTLCNSDSIDIVFKSKSAIRNGEEDATQMCKLKISPSSVDTAELCHKVSSSANNCVDSGRNYSWREGLKANRLDESVPDHCNQMQPLIYRWPTFERVGKFDSSALNSKSAFAIFSPSRDSGKSAARVLYFWVGRSFCHGKSRIQLDNNKELGNIEGSDQNQFGYDILTRMGLPKDTPIKIVKEDEEPREFLALLSTP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein-tyrosine-phosphatase MKP1 Protein-tyrosine-phosphatase that act as negative regulator of MPK6 and MPK3 signaling by dephosphorylating and repressing MPK6 and MPK3. Modulates defense response by repressing salicylic acid (SA) production, camalexin biosynthesis and SNC1-mediated responses. Acts as a negative regulator of MPK6-mediated pathogen-associated molecular pattern (PAMP) responses, including MPK6 and MPK3 activation, accumulation of extracellular reactive oxygen species and inhibition of seedling growth. Involved in UV-B stress tolerance. May be involved in salt and genotoxic stress responses.probableQ9C5S1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D0N, chain A
Confidence level:very confident
Coverage over the Query: 302-429
View the alignment between query and template
View the model in PyMOL
Template: 3EMU, chain A
Confidence level:very confident
Coverage over the Query: 147-297
View the alignment between query and template
View the model in PyMOL
Template: 1KCQ, chain A
Confidence level:confident
Coverage over the Query: 740-779,795-836
View the alignment between query and template
View the model in PyMOL