Citrus Sinensis ID: 003246
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 836 | ||||||
| 255577655 | 843 | mitochondrial carrier protein, putative | 0.988 | 0.979 | 0.760 | 0.0 | |
| 224098050 | 842 | predicted protein [Populus trichocarpa] | 0.978 | 0.971 | 0.753 | 0.0 | |
| 225449130 | 829 | PREDICTED: mitochondrial substrate carri | 0.978 | 0.986 | 0.729 | 0.0 | |
| 224112957 | 798 | predicted protein [Populus trichocarpa] | 0.933 | 0.977 | 0.732 | 0.0 | |
| 449449469 | 821 | PREDICTED: mitochondrial substrate carri | 0.967 | 0.985 | 0.729 | 0.0 | |
| 297823387 | 819 | mitochondrial substrate carrier family p | 0.970 | 0.990 | 0.686 | 0.0 | |
| 356533983 | 813 | PREDICTED: mitochondrial substrate carri | 0.949 | 0.976 | 0.699 | 0.0 | |
| 30686563 | 823 | mitochondrial substrate carrier family p | 0.967 | 0.982 | 0.678 | 0.0 | |
| 357443387 | 796 | Mitochondrial glutamate carrier [Medicag | 0.937 | 0.984 | 0.691 | 0.0 | |
| 356576189 | 811 | PREDICTED: mitochondrial substrate carri | 0.942 | 0.971 | 0.693 | 0.0 |
| >gi|255577655|ref|XP_002529704.1| mitochondrial carrier protein, putative [Ricinus communis] gi|223530806|gb|EEF32670.1| mitochondrial carrier protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1255 bits (3248), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 649/853 (76%), Positives = 730/853 (85%), Gaps = 27/853 (3%)
Query: 1 MVSANDPIESFFNSIQHFKETLSPIELGIKKAAKDLESCLVADKKN-VNNLELV---NGN 56
MVSANDP+E F NSIQ K+ LSP+ELGI+KAAKDLE+C KKN +N+EL NGN
Sbjct: 1 MVSANDPMEPFLNSIQVVKDALSPLELGIRKAAKDLENCWGVSKKNRASNIELNSTDNGN 60
Query: 57 EKNSKIQTLMKKKGNGNSSGKECGNGQCVGSEEKKKGLLSIRVPVKTFLGMFSPNF---- 112
SK+Q KK N N + N + V EE+KKGL SI+VP+KTFLGMFS N
Sbjct: 61 -NTSKVQICALKKRNFNGN-----NRKSVAVEERKKGL-SIKVPIKTFLGMFSLNLENGC 113
Query: 113 ------GKVEVVSKKGVKDKALDKDDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKR 166
+VEV +K G+KD+ + +DGSCTNCLQFAVTWSLL + F Q+FPSPFK KKR
Sbjct: 114 SKNNGNSRVEV-AKNGLKDREMGNEDGSCTNCLQFAVTWSLLVSTFAQAFPSPFKTSKKR 172
Query: 167 IQKLGEEDKGHLSSCVDGTKSKVSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIG 226
QK+GE++K L C +K+KVS EF + +L+GQ+ A ++D G +EGK V LECFIG
Sbjct: 173 FQKVGEDNKDRLHLCKQVSKAKVSPEFNQKDLQGQV-KAVQDDSGNDQEGKHVSLECFIG 231
Query: 227 FVFDQLIQNLQKFDQLMQESDQKGCDCSPSSSPP--SQFDHLKALISIWEGRKAEVDGFL 284
F+FDQL NLQK DQ +Q+ D K D S+ PP S FDHL+ ++SIWE RK +V+GFL
Sbjct: 232 FIFDQLAHNLQKLDQNLQQMDCKDYDYECSTPPPASSHFDHLRTVMSIWESRKVDVNGFL 291
Query: 285 GNLKFARVGGMPSSIVGVTNSVNEEGENGVSSDSREETGGNSAQKVASGILSIPLSNVER 344
GNLKFARVGG+PSSIVGV++SVNEEG++G+S+ EETGG+SAQK+ASG+LSIPLSNVER
Sbjct: 292 GNLKFARVGGVPSSIVGVSSSVNEEGDDGISAGGGEETGGSSAQKLASGLLSIPLSNVER 351
Query: 345 LRSTLSTVSLTELIELLPQLGRTSKDHPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDG 404
LRSTLSTVSL+ELIEL+PQLGR+SKDHPDKKKL SVQDFFRYTE+EGRRFFEELDRDGDG
Sbjct: 352 LRSTLSTVSLSELIELVPQLGRSSKDHPDKKKLISVQDFFRYTESEGRRFFEELDRDGDG 411
Query: 405 QVNLEDLEIAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSL 464
QV LEDLEIAMRKRKLP RYAREFM+RTRSHLFSKSFGWKQFLSLMEQKE TILRAYTSL
Sbjct: 412 QVTLEDLEIAMRKRKLPSRYAREFMQRTRSHLFSKSFGWKQFLSLMEQKESTILRAYTSL 471
Query: 465 CLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDR 524
CLSKSGTL+KSEILASLKNAGLPANE+NA+AMMRFLNADTEESISYGHFRNFM+LLPSDR
Sbjct: 472 CLSKSGTLKKSEILASLKNAGLPANEDNAMAMMRFLNADTEESISYGHFRNFMLLLPSDR 531
Query: 525 LQDDPRSIWFEAATVVAVPPPVEIPAGSVLKSALAGGLSCALSTSLMHPVDTIKTRVQAS 584
LQDDPRSIWFEAATVVAV PPVEIPAGSVL+SALAGGLSCALS SLMHPVDTIKTRVQAS
Sbjct: 532 LQDDPRSIWFEAATVVAVAPPVEIPAGSVLRSALAGGLSCALSCSLMHPVDTIKTRVQAS 591
Query: 585 TLTFPEIIAKLPQIGVRALYRGSIPAILGQFSSHGLRTGIYEVSKLVLLNVAPNLQELQV 644
TLTFPEII+KLP+IGV+ LYRGSIPAILGQFSSHGLRTGI+E SKL+L+NVAP L ELQV
Sbjct: 592 TLTFPEIISKLPEIGVKGLYRGSIPAILGQFSSHGLRTGIFEASKLLLINVAPTLPELQV 651
Query: 645 QSISSFCSTFLGTAVRIPCEVLKQRLQAGLFNNVGEAIVGTWHQDGLKGFFRGTGATLCR 704
QSISSFCSTFLGTAVRIPCEVLKQRLQAGLF+NVG+AI+GTW QDGLKGFFRGTGATLCR
Sbjct: 652 QSISSFCSTFLGTAVRIPCEVLKQRLQAGLFDNVGQAIIGTWQQDGLKGFFRGTGATLCR 711
Query: 705 EVPFYVVGTGLYGESKKMVQQLLGRELEPWETIFVGALSGGLTAVITTPFDVMKTRMMTA 764
EVPFYV G GLY ESKK QQLL RELEPWETIFVGALSGGL AV+TTPFDVMKTRMMTA
Sbjct: 712 EVPFYVAGMGLYAESKKFAQQLLRRELEPWETIFVGALSGGLAAVVTTPFDVMKTRMMTA 771
Query: 765 PQGRAATMSMVAYTILRHEGPLGLFKGALPRFFWIAPLGAMNFAGYELAKKAMDKNDE-V 823
QGR+ MSMVA++ILRHEGPLGLFKGA+PRFFWIAPLGAMNFAGYELA+KAMDK++E
Sbjct: 772 -QGRSLPMSMVAFSILRHEGPLGLFKGAVPRFFWIAPLGAMNFAGYELARKAMDKHEEST 830
Query: 824 ADELSQKKLASSG 836
+D+ SQKKL SSG
Sbjct: 831 SDQPSQKKLTSSG 843
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224098050|ref|XP_002311112.1| predicted protein [Populus trichocarpa] gi|222850932|gb|EEE88479.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225449130|ref|XP_002277407.1| PREDICTED: mitochondrial substrate carrier family protein C [Vitis vinifera] gi|296086059|emb|CBI31500.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224112957|ref|XP_002316345.1| predicted protein [Populus trichocarpa] gi|222865385|gb|EEF02516.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449449469|ref|XP_004142487.1| PREDICTED: mitochondrial substrate carrier family protein C-like [Cucumis sativus] gi|449487287|ref|XP_004157552.1| PREDICTED: mitochondrial substrate carrier family protein C-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297823387|ref|XP_002879576.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297325415|gb|EFH55835.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356533983|ref|XP_003535537.1| PREDICTED: mitochondrial substrate carrier family protein C-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30686563|ref|NP_850252.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] gi|17380984|gb|AAL36304.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|20466023|gb|AAM20346.1| putative mitochondrial carrier protein [Arabidopsis thaliana] gi|330254069|gb|AEC09163.1| mitochondrial substrate carrier family protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357443387|ref|XP_003591971.1| Mitochondrial glutamate carrier [Medicago truncatula] gi|355481019|gb|AES62222.1| Mitochondrial glutamate carrier [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356576189|ref|XP_003556216.1| PREDICTED: mitochondrial substrate carrier family protein C-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 836 | ||||||
| TAIR|locus:2039225 | 823 | SAMTL "S-adenosyl methionine t | 0.971 | 0.986 | 0.653 | 1.3e-281 | |
| TAIR|locus:2066266 | 387 | AT2G26360 [Arabidopsis thalian | 0.319 | 0.689 | 0.712 | 7.9e-101 | |
| UNIPROTKB|Q6GLA2 | 269 | slc25a26 "S-adenosylmethionine | 0.302 | 0.940 | 0.323 | 2.6e-28 | |
| UNIPROTKB|Q641C8 | 266 | slc25a26 "S-adenosylmethionine | 0.301 | 0.947 | 0.325 | 4.3e-28 | |
| TAIR|locus:505006167 | 345 | SAMC2 "S-adenosylmethionine ca | 0.312 | 0.756 | 0.317 | 4.3e-28 | |
| TAIR|locus:2122452 | 325 | SAMC1 "S-adenosylmethionine ca | 0.306 | 0.787 | 0.308 | 2.5e-27 | |
| FB|FBgn0039357 | 283 | CG4743 [Drosophila melanogaste | 0.302 | 0.893 | 0.315 | 6.6e-27 | |
| ZFIN|ZDB-GENE-050913-126 | 267 | slc25a26 "solute carrier famil | 0.302 | 0.947 | 0.310 | 1.8e-26 | |
| SGD|S000004948 | 284 | PET8 "S-adenosylmethionine tra | 0.319 | 0.940 | 0.317 | 2.7e-25 | |
| MGI|MGI:1914832 | 274 | Slc25a26 "solute carrier famil | 0.303 | 0.927 | 0.296 | 4.5e-25 |
| TAIR|locus:2039225 SAMTL "S-adenosyl methionine transporter-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2706 (957.6 bits), Expect = 1.3e-281, P = 1.3e-281
Identities = 550/842 (65%), Positives = 639/842 (75%)
Query: 1 MVSANDPIESFFNSIQHFKET-LSPIELGIKKAAKDLESCLVADKXXXXXXXXXXXXXXX 59
MVS ND IE+ FNSIQ K+ L PIELG+KKAA+D+E+C ++ +
Sbjct: 1 MVSKNDHIETLFNSIQLVKDVVLLPIELGVKKAARDIENCWISKERDLGLVFRSSGRNRK 60
Query: 60 SKIQTLMXXXXXXXXXXXXXXXXQCVG-SEEKKKGLLSIRVPVKTFLGMFSPNFGXXXXX 118
+I QCV ++E+KKGL ++PVK+ GMFSPN
Sbjct: 61 KRI------VATPEFDDNATNNVQCVVVTDERKKGLSIKKIPVKSLFGMFSPNLVSEKLS 114
Query: 119 XXXXXXXXALDK-----DDGSCTNCLQFAVTWSLLFNGFVQSFPSPFKMGKKRIQKLGEE 173
DK DD SCT+C +FA+TWSLL +GFV +FP PFK+GKKRI K+G+
Sbjct: 115 RGNDVVVAKKDKSLEKKDDDSCTDCFKFAMTWSLLVSGFVHAFPIPFKIGKKRIHKMGD- 173
Query: 174 DKGHLSSCVDGTKSKVSCEFKRNELKGQLDNACKNDGGAGKEGKPVLLECFIGFVFDQLI 233
D+ L G KSK + R E++ C++ KEG P +EC +GFV + L
Sbjct: 174 DENSLRK--HGLKSKAAF-VSRKEVR------CQSVESVEKEGNPFSIECAVGFVVEMLA 224
Query: 234 QNLQKFDQLMQESDQKGCDCXXXXXXXXQFDHLKALISIWEGRKAEVDGFLGNLKFARVG 293
QNLQK DQ +Q+S + C + +IWE RK +V+GFLGNL FARVG
Sbjct: 225 QNLQKLDQFIQDSSENESCCSKEASSNDS----PLIFNIWEARKLDVNGFLGNLMFARVG 280
Query: 294 GMPSSIVGVTNSVNEEG-ENGVSSDSREETGGNSAQKVASGILSIPLSNVERLRSTLSTV 352
+ S I G+T+ ++E+G E+ VS+ +EE+ +S Q +A+G+LSIPLSNVERL+STLST+
Sbjct: 281 DVASGIGGLTSHISEDGDESNVSTAGKEESAVDSPQNLATGLLSIPLSNVERLKSTLSTI 340
Query: 353 SLTELIELLPQLGRTSKDHPDKKKLFSVQDFFRYTEAEGRRFFEELDRDGDGQVNLEDLE 412
SLTELIELLPQLGR S+DHPDKKKL SVQDFFRYTE+EGRRFFEELDRDGDG+V LEDLE
Sbjct: 341 SLTELIELLPQLGRPSRDHPDKKKLISVQDFFRYTESEGRRFFEELDRDGDGKVTLEDLE 400
Query: 413 IAMRKRKLPRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLSKSGTL 472
IAMR+RKLPRRYA+EFMRR RSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCL+KSGTL
Sbjct: 401 IAMRRRKLPRRYAKEFMRRARSHLFSKSFGWKQFLSLMEQKEPTILRAYTSLCLTKSGTL 460
Query: 473 QKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSI 532
+KSEILASL NAGLPANEENA+AMMRFL ADTEESISYGHFRNFMVLLP +RLQDDPR+I
Sbjct: 461 KKSEILASLNNAGLPANEENAIAMMRFLKADTEESISYGHFRNFMVLLPYERLQDDPRNI 520
Query: 533 WFEXXXXXXXXXXXXXXXGSVLKSALAGGLSCALSTSLMHPVDTIKTRVQASTLTFPEII 592
WFE G VLKSALAGGL+ ALSTSLMHP+DTIKTRVQASTL+FPE+I
Sbjct: 521 WFEAATVVAVAPPVALPAGDVLKSALAGGLASALSTSLMHPIDTIKTRVQASTLSFPEVI 580
Query: 593 AKLPQIGVRALYRGSIPAILGQFSSHGLRTGIYEVSKLVLLNVAPNLQELQVQSISSFCS 652
AKLP+IGVR +YRGSIPAILGQFSSHGLRTGI+E SKLVL+N APNL E+QVQSI+SFCS
Sbjct: 581 AKLPEIGVRGVYRGSIPAILGQFSSHGLRTGIFEASKLVLINFAPNLPEIQVQSIASFCS 640
Query: 653 TFLGTAVRIPCEVLKQRLQAGLFNNVGEAIVGTWHQDGLKGFFRGTGATLCREVPFYVVG 712
T LGTAVRIPCEVLKQRLQAG+FNNVGEAIVGTW QDG GFFRGTGATLCREVP YVVG
Sbjct: 641 TLLGTAVRIPCEVLKQRLQAGMFNNVGEAIVGTWKQDGPSGFFRGTGATLCREVPLYVVG 700
Query: 713 TGLYGESKKMVQQLLGRELEPWETIFVGALSGGLTAVITTPFDVMKTRMMTAPQGRAATM 772
GLY ESKKMV Q LGRELE WETI VGA+SGG+ AV+TTPFDVMKTRMMTA GR +M
Sbjct: 701 MGLYAESKKMVAQALGRELEAWETIAVGAVSGGIAAVVTTPFDVMKTRMMTATPGRPISM 760
Query: 773 SMVAYTILRHEGPLGLFKGALPRFFWIAPLGAMNFAGYELAKKAMDKNDE--VADELSQK 830
SMV +ILR+EGPLGLFKGA+PRFFW+APLGAMNFAGYELAKKAM KN++ +AD+L QK
Sbjct: 761 SMVVVSILRNEGPLGLFKGAVPRFFWVAPLGAMNFAGYELAKKAMQKNEDAVLADQLGQK 820
Query: 831 KL 832
KL
Sbjct: 821 KL 822
|
|
| TAIR|locus:2066266 AT2G26360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6GLA2 slc25a26 "S-adenosylmethionine mitochondrial carrier protein" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q641C8 slc25a26 "S-adenosylmethionine mitochondrial carrier protein" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006167 SAMC2 "S-adenosylmethionine carrier 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2122452 SAMC1 "S-adenosylmethionine carrier 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0039357 CG4743 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050913-126 slc25a26 "solute carrier family 25, member 26" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004948 PET8 "S-adenosylmethionine transporter of the mitochondrial inner membrane" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914832 Slc25a26 "solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 26" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 836 | |||
| pfam00153 | 96 | pfam00153, Mito_carr, Mitochondrial carrier protei | 2e-21 | |
| PTZ00168 | 259 | PTZ00168, PTZ00168, mitochondrial carrier protein; | 3e-20 | |
| pfam00153 | 96 | pfam00153, Mito_carr, Mitochondrial carrier protei | 2e-15 | |
| pfam00153 | 96 | pfam00153, Mito_carr, Mitochondrial carrier protei | 1e-09 | |
| PTZ00169 | 300 | PTZ00169, PTZ00169, ADP/ATP transporter on adenyla | 2e-04 | |
| PTZ00169 | 300 | PTZ00169, PTZ00169, ADP/ATP transporter on adenyla | 2e-04 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 0.003 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 0.004 |
| >gnl|CDD|215754 pfam00153, Mito_carr, Mitochondrial carrier protein | Back alignment and domain information |
|---|
Score = 89.6 bits (223), Expect = 2e-21
Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 3/91 (3%)
Query: 730 ELEPWETIFVGALSGGLTAVITTPFDVMKTRMMTAPQG---RAATMSMVAYTILRHEGPL 786
L ++ G ++G + A +T P DV+KTR+ ++ G + + I + EG
Sbjct: 2 PLSFLASLLAGGIAGAIAATVTYPLDVVKTRLQSSAAGGSRKYKGILDCFKKIYKEEGIR 61
Query: 787 GLFKGALPRFFWIAPLGAMNFAGYELAKKAM 817
GL+KG LP +AP A+ F YE KK +
Sbjct: 62 GLYKGLLPNLLRVAPAAAIYFGTYETLKKLL 92
|
Length = 96 |
| >gnl|CDD|185494 PTZ00168, PTZ00168, mitochondrial carrier protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215754 pfam00153, Mito_carr, Mitochondrial carrier protein | Back alignment and domain information |
|---|
| >gnl|CDD|215754 pfam00153, Mito_carr, Mitochondrial carrier protein | Back alignment and domain information |
|---|
| >gnl|CDD|240302 PTZ00169, PTZ00169, ADP/ATP transporter on adenylate translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240302 PTZ00169, PTZ00169, ADP/ATP transporter on adenylate translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 836 | |||
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 100.0 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 100.0 | |
| KOG0764 | 299 | consensus Mitochondrial FAD carrier protein [Energ | 100.0 | |
| KOG0752 | 320 | consensus Mitochondrial solute carrier protein [En | 100.0 | |
| PTZ00169 | 300 | ADP/ATP transporter on adenylate translocase; Prov | 100.0 | |
| KOG0758 | 297 | consensus Mitochondrial carnitine-acylcarnitine ca | 100.0 | |
| KOG0760 | 302 | consensus Mitochondrial carrier protein MRS3/4 [En | 100.0 | |
| PTZ00168 | 259 | mitochondrial carrier protein; Provisional | 100.0 | |
| KOG0768 | 323 | consensus Mitochondrial carrier protein PET8 [Ener | 100.0 | |
| KOG0759 | 286 | consensus Mitochondrial oxoglutarate/malate carrie | 100.0 | |
| KOG0753 | 317 | consensus Mitochondrial fatty acid anion carrier p | 100.0 | |
| KOG0757 | 319 | consensus Mitochondrial carrier protein - Rim2p/Mr | 100.0 | |
| KOG0762 | 311 | consensus Mitochondrial carrier protein [Energy pr | 100.0 | |
| KOG0754 | 294 | consensus Mitochondrial oxodicarboxylate carrier p | 100.0 | |
| KOG0761 | 361 | consensus Mitochondrial carrier protein CGI-69 [En | 100.0 | |
| KOG0766 | 297 | consensus Predicted mitochondrial carrier protein | 100.0 | |
| KOG0770 | 353 | consensus Predicted mitochondrial carrier protein | 100.0 | |
| KOG0765 | 333 | consensus Predicted mitochondrial carrier protein | 100.0 | |
| KOG0769 | 308 | consensus Predicted mitochondrial carrier protein | 100.0 | |
| KOG0749 | 298 | consensus Mitochondrial ADP/ATP carrier proteins [ | 100.0 | |
| KOG0756 | 299 | consensus Mitochondrial tricarboxylate/dicarboxyla | 100.0 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 100.0 | |
| KOG0755 | 320 | consensus Mitochondrial oxaloacetate carrier prote | 100.0 | |
| KOG0750 | 304 | consensus Mitochondrial solute carrier protein [En | 100.0 | |
| KOG0763 | 301 | consensus Mitochondrial ornithine transporter [Ene | 100.0 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 99.97 | |
| KOG0764 | 299 | consensus Mitochondrial FAD carrier protein [Energ | 99.96 | |
| KOG0767 | 333 | consensus Mitochondrial phosphate carrier protein | 99.96 | |
| KOG0752 | 320 | consensus Mitochondrial solute carrier protein [En | 99.95 | |
| PTZ00169 | 300 | ADP/ATP transporter on adenylate translocase; Prov | 99.95 | |
| KOG0757 | 319 | consensus Mitochondrial carrier protein - Rim2p/Mr | 99.95 | |
| KOG0753 | 317 | consensus Mitochondrial fatty acid anion carrier p | 99.94 | |
| KOG0760 | 302 | consensus Mitochondrial carrier protein MRS3/4 [En | 99.94 | |
| PTZ00168 | 259 | mitochondrial carrier protein; Provisional | 99.93 | |
| KOG0758 | 297 | consensus Mitochondrial carnitine-acylcarnitine ca | 99.93 | |
| KOG0768 | 323 | consensus Mitochondrial carrier protein PET8 [Ener | 99.92 | |
| KOG0762 | 311 | consensus Mitochondrial carrier protein [Energy pr | 99.92 | |
| KOG0759 | 286 | consensus Mitochondrial oxoglutarate/malate carrie | 99.92 | |
| KOG0754 | 294 | consensus Mitochondrial oxodicarboxylate carrier p | 99.91 | |
| KOG0761 | 361 | consensus Mitochondrial carrier protein CGI-69 [En | 99.9 | |
| KOG0770 | 353 | consensus Predicted mitochondrial carrier protein | 99.9 | |
| KOG1519 | 297 | consensus Predicted mitochondrial carrier protein | 99.86 | |
| KOG0767 | 333 | consensus Mitochondrial phosphate carrier protein | 99.85 | |
| KOG0763 | 301 | consensus Mitochondrial ornithine transporter [Ene | 99.83 | |
| KOG0766 | 297 | consensus Predicted mitochondrial carrier protein | 99.83 | |
| KOG0769 | 308 | consensus Predicted mitochondrial carrier protein | 99.83 | |
| KOG0755 | 320 | consensus Mitochondrial oxaloacetate carrier prote | 99.83 | |
| KOG0765 | 333 | consensus Predicted mitochondrial carrier protein | 99.82 | |
| KOG0750 | 304 | consensus Mitochondrial solute carrier protein [En | 99.81 | |
| KOG0756 | 299 | consensus Mitochondrial tricarboxylate/dicarboxyla | 99.79 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.75 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.74 | |
| KOG0749 | 298 | consensus Mitochondrial ADP/ATP carrier proteins [ | 99.71 | |
| PTZ00183 | 158 | centrin; Provisional | 99.64 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.61 | |
| KOG2745 | 321 | consensus Mitochondrial carrier protein [General f | 99.59 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.59 | |
| PF00153 | 95 | Mito_carr: Mitochondrial carrier protein; InterPro | 99.58 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.56 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.49 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 99.48 | |
| KOG1519 | 297 | consensus Predicted mitochondrial carrier protein | 99.39 | |
| KOG2954 | 427 | consensus Mitochondrial carrier protein [General f | 99.33 | |
| PF00153 | 95 | Mito_carr: Mitochondrial carrier protein; InterPro | 99.32 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.28 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 99.25 | |
| KOG2745 | 321 | consensus Mitochondrial carrier protein [General f | 99.25 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.23 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 99.19 | |
| PF08976 | 118 | DUF1880: Domain of unknown function (DUF1880); Int | 99.19 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.11 | |
| PTZ00183 | 158 | centrin; Provisional | 99.03 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 99.03 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.01 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 98.95 | |
| PTZ00184 | 149 | calmodulin; Provisional | 98.93 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 98.89 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.77 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 98.76 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.75 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.75 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 98.64 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 98.6 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.59 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 98.46 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.45 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 98.45 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.43 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 98.42 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.39 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.38 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.34 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.34 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.31 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 98.27 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.24 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 98.23 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 98.21 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.2 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.19 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 98.16 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.14 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 98.13 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 98.11 | |
| KOG2954 | 427 | consensus Mitochondrial carrier protein [General f | 98.06 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 98.05 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.03 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 97.99 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 97.98 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 97.95 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 97.94 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 97.93 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 97.9 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 97.89 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 97.89 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 97.82 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 97.81 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 97.81 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 97.74 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 97.73 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 97.69 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 97.61 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 97.5 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 97.36 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 97.35 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 97.29 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 97.29 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 97.23 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 97.15 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 97.07 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 97.02 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 96.93 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 96.92 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 96.9 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 96.47 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 96.41 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 96.18 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 96.16 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 96.09 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.05 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 96.0 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 95.94 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 95.86 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 95.54 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 95.53 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 95.53 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 95.45 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 95.3 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 94.79 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 93.63 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 93.3 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 93.23 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 92.73 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 92.23 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 91.83 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 91.82 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 90.51 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 86.42 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 85.32 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 82.59 |
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.8e-59 Score=495.38 Aligned_cols=427 Identities=22% Similarity=0.369 Sum_probs=382.7
Q ss_pred cHHHHHHHHHHHcCCCCCCccHHHHHHHHHhCCC---CHHHHHHHHHHHhcCCCCCccchHHHHhhhhcchhHHHHHhhh
Q 003246 387 TEAEGRRFFEELDRDGDGQVNLEDLEIAMRKRKL---PRRYAREFMRRTRSHLFSKSFGWKQFLSLMEQKEPTILRAYTS 463 (836)
Q Consensus 387 ~e~~lr~~F~~fD~D~dG~Is~~EL~~~L~~l~l---~~~ei~~l~~~~D~d~~dG~Isf~EF~~~l~~~~~~l~~aF~~ 463 (836)
.+.+++.+|+.||.+++|.++..++...+..+.. +.+..+.++...|.+ .||+++|.||..++..++..+.++|+.
T Consensus 12 r~~r~~~lf~~lD~~~~g~~d~~~l~k~~~~l~~~~~~~~~~~~l~~~~d~~-~dg~vDy~eF~~Y~~~~E~~l~~~F~~ 90 (463)
T KOG0036|consen 12 RDIRIRCLFKELDSKNDGQVDLDQLEKGLEKLDHPKPNYEAAKMLFSAMDAN-RDGRVDYSEFKRYLDNKELELYRIFQS 90 (463)
T ss_pred HHHHHHHHHHHhccCCCCceeHHHHHHHHHhcCCCCCchHHHHHHHHhcccC-cCCcccHHHHHHHHHHhHHHHHHHHhh
Confidence 4578899999999999999999999999998654 458889999999999 999999999999999999999999999
Q ss_pred hccCCCccccHHHHHHHHHhcCCCCcHHHHHHHHHHchhcCCCcccccccccccccCCCCCCCCCcchhhhhhhhhcCCC
Q 003246 464 LCLSKSGTLQKSEILASLKNAGLPANEENAVAMMRFLNADTEESISYGHFRNFMVLLPSDRLQDDPRSIWFEAATVVAVP 543 (836)
Q Consensus 464 ~D~dgdG~Is~eEf~~~L~~~g~~lseeei~~i~~~~D~d~DG~Isy~EF~~~l~~lp~~~Lq~~~~~~~~~~~~~~~~~ 543 (836)
.|.++||.|..+|+.+.|+.+|+++++++++.+++.+|.++++.|+++||.+++++.|...+++ ...+|-... .+++.
T Consensus 91 iD~~hdG~i~~~Ei~~~l~~~gi~l~de~~~k~~e~~d~~g~~~I~~~e~rd~~ll~p~s~i~d-i~~~W~h~~-~idig 168 (463)
T KOG0036|consen 91 IDLEHDGKIDPNEIWRYLKDLGIQLSDEKAAKFFEHMDKDGKATIDLEEWRDHLLLYPESDLED-IYDFWRHVL-LIDIG 168 (463)
T ss_pred hccccCCccCHHHHHHHHHHhCCccCHHHHHHHHHHhccCCCeeeccHHHHhhhhcCChhHHHH-HHHhhhhhe-EEEcc
Confidence 9999999999999999999999999999999999999999999999999999999999877763 334564332 34555
Q ss_pred CCCCCCh---------hhHHHHHHHHHHHHHHHHHhhhhHHHHHHHHhhCCCC------hHHHHHHhhhccccccccCcH
Q 003246 544 PPVEIPA---------GSVLKSALAGGLSCALSTSLMHPVDTIKTRVQASTLT------FPEIIAKLPQIGVRALYRGSI 608 (836)
Q Consensus 544 ~~~~~~~---------~~~l~~~lAG~vAg~vs~~v~~PLD~IKtrlQ~~~~~------~~~i~~ilr~eGi~gLYRG~~ 608 (836)
....+|. ...|+.++||++||++++++|.|||++|+-+|++.+. ..++..++++.|+++||||.+
T Consensus 169 E~~~iPdg~s~~e~~~g~ww~~liAGGiAGavSRTcTAPlDRLKV~lqv~~~k~~~~~v~~~~k~l~~eggiksf~rGNG 248 (463)
T KOG0036|consen 169 EDAVLPDGDSKLENDSGRWWGFLIAGGIAGAVSRTCTAPLDRLKVFLQVQSPKANILPLLKAVKSLWREGGIKSFFRGNG 248 (463)
T ss_pred ccccCCcchHHHHhcccchhhhhccccccccccccccCchhhhheeeeccCCCCCcccHHHHHHHHHhccCceeeeccCc
Confidence 5555443 4578999999999999999999999999999998743 346677789999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHhhcCCChhHHHHHHHHHHHHhhhhhcccCcHHHHHHHHHcC---CCCCHHHHHHHH
Q 003246 609 PAILGQFSSHGLRTGIYEVSKLVLLNVAPNLQELQVQSISSFCSTFLGTAVRIPCEVLKQRLQAG---LFNNVGEAIVGT 685 (836)
Q Consensus 609 ~~ll~~~~~~~l~f~~ye~lk~~l~~~~~~~~~~~~~~lag~~Ag~vs~~v~~PldvIKtRlQ~~---~~~~~~~~l~~I 685 (836)
.+++..+|.+++.|..|+.+|+.+.............++||..||+++.+..||+|++|||+|.. .+.+.+.+.+.+
T Consensus 249 iNViKvaPESaIKF~ayE~~Kr~i~~~~~e~ls~~~rl~AGglAGavAQ~~IYPmd~lKtRlq~~~~~~~~~~l~~ak~i 328 (463)
T KOG0036|consen 249 LNVIKVAPESAIKFGAYEQTKRIIGGCDDEDLSTFERLLAGGLAGAVAQTSIYPMDTLKTRLQCRPLGQGKGLLKLAKDI 328 (463)
T ss_pred eeeEEecchhhHhhhhHHHHHHHhccCchhhcchhhhhhccCchhHHHHhhcChHHHHHHHhhcccccchhhhhhhhhhH
Confidence 99999999999999999999999975443344556678999999999999999999999999974 456789999999
Q ss_pred HHhcCcccccccccccccccchhhhHHHHHHHHHHHHHHHhhCC--CCChhHHHHHHHHHHHHHHHhhchHHHHHHHHHc
Q 003246 686 WHQDGLKGFFRGTGATLCREVPFYVVGTGLYGESKKMVQQLLGR--ELEPWETIFVGALSGGLTAVITTPFDVMKTRMMT 763 (836)
Q Consensus 686 ~r~eGi~gLYrG~~ptllr~vp~~~l~f~~Ye~lk~~l~~~~~~--~~~~~~~~~aG~lAG~vas~it~PlDvIKtRlQ~ 763 (836)
|.++|+++||+|+.|++++.+||.++-++.|+.++......... +++++..+.+|.++|.++++.+||+-+||||||+
T Consensus 329 l~~eg~r~FykG~~p~llGIiPyagidLa~yetLk~~~~~y~~~~~~pg~lv~lacGt~S~tcGq~~syPL~lVRTRmQa 408 (463)
T KOG0036|consen 329 LFQEGPRAFYKGYLPNLLGIIPYAGIDLAVYETLKDTWRTYFLDDAEPGPLVLLACGTISGTCGQTASYPLALVRTRMQA 408 (463)
T ss_pred HHhhhHHHHHhccccceeEecccccchHHHHHHHHHHHHHhcccccCCCceeEEeecchhhhhcccccCcHHHHHHHHhc
Confidence 99999999999999999999999999999999999998655433 4678888999999999999999999999999999
Q ss_pred CCCCCCCcHHHHHHHHHHhhCcccccccHHHHHHHHhhhHhhHHHHHHHHHHHHh
Q 003246 764 APQGRAATMSMVAYTILRHEGPLGLFKGALPRFFWIAPLGAMNFAGYELAKKAMD 818 (836)
Q Consensus 764 ~~~~~~~s~~~~~~~I~r~eGl~gLYrG~~~~llr~~p~~ai~f~~YE~lk~~l~ 818 (836)
++. +.++..|+++++++||++|||||+.|+++++.|..+|++.+||.+|+.+.
T Consensus 409 q~~--~~tm~g~f~~~l~~eG~~glyrgl~PN~lKv~pa~siSy~VYEamkk~lg 461 (463)
T KOG0036|consen 409 QGG--KDTMSGCFQWTLRNEGFRGLYRGLFPNLLKVPPAVSISYVVYEAMKKTLG 461 (463)
T ss_pred cCC--CCcHHHHHHHHHHhhhHHHHHhhcCCccccccccceeehhhHHHHHHhcC
Confidence 864 77899999999999999999999999999999999999999999999774
|
|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0764 consensus Mitochondrial FAD carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0752 consensus Mitochondrial solute carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00169 ADP/ATP transporter on adenylate translocase; Provisional | Back alignment and domain information |
|---|
| >KOG0758 consensus Mitochondrial carnitine-acylcarnitine carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0760 consensus Mitochondrial carrier protein MRS3/4 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00168 mitochondrial carrier protein; Provisional | Back alignment and domain information |
|---|
| >KOG0768 consensus Mitochondrial carrier protein PET8 [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0759 consensus Mitochondrial oxoglutarate/malate carrier proteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0753 consensus Mitochondrial fatty acid anion carrier protein/Uncoupling protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0757 consensus Mitochondrial carrier protein - Rim2p/Mrs12p [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0762 consensus Mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0754 consensus Mitochondrial oxodicarboxylate carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0761 consensus Mitochondrial carrier protein CGI-69 [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0766 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0770 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0765 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0769 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0749 consensus Mitochondrial ADP/ATP carrier proteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0756 consensus Mitochondrial tricarboxylate/dicarboxylate carrier proteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0755 consensus Mitochondrial oxaloacetate carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0750 consensus Mitochondrial solute carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0763 consensus Mitochondrial ornithine transporter [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0764 consensus Mitochondrial FAD carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0767 consensus Mitochondrial phosphate carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0752 consensus Mitochondrial solute carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00169 ADP/ATP transporter on adenylate translocase; Provisional | Back alignment and domain information |
|---|
| >KOG0757 consensus Mitochondrial carrier protein - Rim2p/Mrs12p [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0753 consensus Mitochondrial fatty acid anion carrier protein/Uncoupling protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0760 consensus Mitochondrial carrier protein MRS3/4 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00168 mitochondrial carrier protein; Provisional | Back alignment and domain information |
|---|
| >KOG0758 consensus Mitochondrial carnitine-acylcarnitine carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0768 consensus Mitochondrial carrier protein PET8 [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0762 consensus Mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0759 consensus Mitochondrial oxoglutarate/malate carrier proteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0754 consensus Mitochondrial oxodicarboxylate carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0761 consensus Mitochondrial carrier protein CGI-69 [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0770 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1519 consensus Predicted mitochondrial carrier protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0767 consensus Mitochondrial phosphate carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0763 consensus Mitochondrial ornithine transporter [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0766 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0769 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0755 consensus Mitochondrial oxaloacetate carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0765 consensus Predicted mitochondrial carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0750 consensus Mitochondrial solute carrier protein [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0756 consensus Mitochondrial tricarboxylate/dicarboxylate carrier proteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0749 consensus Mitochondrial ADP/ATP carrier proteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2745 consensus Mitochondrial carrier protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PF00153 Mito_carr: Mitochondrial carrier protein; InterPro: IPR018108 A variety of substrate carrier proteins that are involved in energy transfer are found in the inner mitochondrial membrane or integral to the membrane of other eukaryotic organelles such as the peroxisome [, , , , , ] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1519 consensus Predicted mitochondrial carrier protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2954 consensus Mitochondrial carrier protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00153 Mito_carr: Mitochondrial carrier protein; InterPro: IPR018108 A variety of substrate carrier proteins that are involved in energy transfer are found in the inner mitochondrial membrane or integral to the membrane of other eukaryotic organelles such as the peroxisome [, , , , , ] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2745 consensus Mitochondrial carrier protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >KOG2954 consensus Mitochondrial carrier protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 836 | ||||
| 2lck_A | 303 | Structure Of The Mitochondrial Uncoupling Protein 2 | 5e-14 | ||
| 2lck_A | 303 | Structure Of The Mitochondrial Uncoupling Protein 2 | 4e-06 | ||
| 1okc_A | 297 | Structure Of Mitochondrial AdpATP CARRIER IN COMPLE | 3e-09 |
| >pdb|2LCK|A Chain A, Structure Of The Mitochondrial Uncoupling Protein 2 Determined By Nmr Molecular Fragment Replacement Length = 303 | Back alignment and structure |
|
| >pdb|2LCK|A Chain A, Structure Of The Mitochondrial Uncoupling Protein 2 Determined By Nmr Molecular Fragment Replacement Length = 303 | Back alignment and structure |
| >pdb|1OKC|A Chain A, Structure Of Mitochondrial AdpATP CARRIER IN COMPLEX WITH Carboxyatractyloside Length = 297 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 836 | |||
| 2lck_A | 303 | Mitochondrial uncoupling protein 2; membrane prote | 2e-48 | |
| 2lck_A | 303 | Mitochondrial uncoupling protein 2; membrane prote | 1e-23 | |
| 2lck_A | 303 | Mitochondrial uncoupling protein 2; membrane prote | 6e-19 | |
| 1okc_A | 297 | ADP, ATP carrier protein heart isoform T1; mitocho | 1e-37 | |
| 1okc_A | 297 | ADP, ATP carrier protein heart isoform T1; mitocho | 3e-23 | |
| 1okc_A | 297 | ADP, ATP carrier protein heart isoform T1; mitocho | 6e-09 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 1e-07 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 8e-07 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 1e-06 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 1e-06 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 2e-06 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 9e-06 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 3e-05 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 5e-04 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 1e-04 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-04 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 1e-04 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 2e-04 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 3e-04 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 6e-04 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 6e-04 |
| >2lck_A Mitochondrial uncoupling protein 2; membrane protein, proton translocator, mitochondrial carrier transport protein, structural genomics; NMR {Mus musculus} Length = 303 | Back alignment and structure |
|---|
Score = 172 bits (438), Expect = 2e-48
Identities = 66/290 (22%), Positives = 121/290 (41%), Gaps = 23/290 (7%)
Query: 558 LAGGLSCALSTSLMHPVDTIKTRVQ-----------ASTLTFPEIIAKLPQI----GVRA 602
L G + ++ + P+DT K R+Q A++ + ++ + + G R+
Sbjct: 6 LGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYRGVLGTILTMVRTEGPRS 65
Query: 603 LYRGSIPAILGQFSSHGLRTGIYEVSKLVLLNVAPNLQELQVQSISSFCSTFLGTAVRIP 662
LY G + + Q S +R G+Y+ K + + + + ++ + L AV P
Sbjct: 66 LYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAG-IGSRLLAGSTTGALAVAVAQP 124
Query: 663 CEVLKQRLQAGL-------FNNVGEAIVGTWHQDGLKGFFRGTGATLCREVPFYVVGTGL 715
+V+K R QA + + EA ++G++G ++GT + R
Sbjct: 125 TDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVT 184
Query: 716 YGESKKMVQQLLGRELEPWETIFVGALSGGLTAVITTPFDVMKTRMMTAPQGRAATMSMV 775
Y K + + + +G T VI +P DV+KTR M + G+ +
Sbjct: 185 YDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAGHC 244
Query: 776 AYTILRHEGPLGLFKGALPRFFWIAPLGAMNFAGYELAKKAMDKNDEVAD 825
A T+LR EGP +KG +P F + + F YE K+A+ + +
Sbjct: 245 ALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAAYQSRE 294
|
| >2lck_A Mitochondrial uncoupling protein 2; membrane protein, proton translocator, mitochondrial carrier transport protein, structural genomics; NMR {Mus musculus} Length = 303 | Back alignment and structure |
|---|
| >2lck_A Mitochondrial uncoupling protein 2; membrane protein, proton translocator, mitochondrial carrier transport protein, structural genomics; NMR {Mus musculus} Length = 303 | Back alignment and structure |
|---|
| >1okc_A ADP, ATP carrier protein heart isoform T1; mitochondrial transporter, nucleotide translocation, membrane protein, transport; HET: CXT CDL LDM PC1; 2.2A {Bos taurus} SCOP: f.42.1.1 PDB: 2c3e_A* Length = 297 | Back alignment and structure |
|---|
| >1okc_A ADP, ATP carrier protein heart isoform T1; mitochondrial transporter, nucleotide translocation, membrane protein, transport; HET: CXT CDL LDM PC1; 2.2A {Bos taurus} SCOP: f.42.1.1 PDB: 2c3e_A* Length = 297 | Back alignment and structure |
|---|
| >1okc_A ADP, ATP carrier protein heart isoform T1; mitochondrial transporter, nucleotide translocation, membrane protein, transport; HET: CXT CDL LDM PC1; 2.2A {Bos taurus} SCOP: f.42.1.1 PDB: 2c3e_A* Length = 297 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 836 | |||
| 2lck_A | 303 | Mitochondrial uncoupling protein 2; membrane prote | 100.0 | |
| 1okc_A | 297 | ADP, ATP carrier protein heart isoform T1; mitocho | 100.0 | |
| 1okc_A | 297 | ADP, ATP carrier protein heart isoform T1; mitocho | 99.96 | |
| 2lck_A | 303 | Mitochondrial uncoupling protein 2; membrane prote | 99.96 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.8 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.79 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.79 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.79 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.78 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.77 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.77 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.77 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.76 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.75 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.75 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.75 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.75 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.74 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.74 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.74 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.74 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.73 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.72 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.72 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.72 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.72 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.72 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.71 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.71 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.71 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.71 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.7 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.7 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.7 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.7 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.7 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.69 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.69 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.69 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.69 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.69 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.69 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.69 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.68 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.68 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.68 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.67 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.67 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.67 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.67 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.67 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.67 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.66 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.66 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.66 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.66 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.66 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.66 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.66 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.66 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.66 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.65 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.65 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.64 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.64 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.64 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.63 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.63 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.63 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.62 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.62 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.61 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.61 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.61 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.61 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.6 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.6 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.6 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.6 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.59 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.59 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.58 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.58 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.58 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.58 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.57 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.57 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.56 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.55 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.55 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.54 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.54 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.54 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.54 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.52 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.51 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.5 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.49 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.49 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.48 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.48 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.47 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.44 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.41 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.39 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.38 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.38 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.36 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.36 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.35 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.35 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.33 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.33 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.32 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.32 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.31 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.3 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.3 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.28 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.27 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.27 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.26 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.26 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.26 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.25 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.25 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.25 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.24 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.24 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.23 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.23 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.23 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.22 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.22 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.22 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.22 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.21 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.21 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.2 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.19 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.19 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.19 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.18 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.17 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.17 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.17 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.17 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.17 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.16 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.16 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.14 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.13 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.13 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.13 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.13 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.12 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.08 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.06 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.06 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.06 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.06 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.06 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.06 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.06 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.05 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.05 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.05 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.04 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.04 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.03 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.03 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.03 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.02 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.02 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.02 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.01 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.01 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.01 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.0 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.0 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 98.99 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 98.99 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 98.98 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 98.98 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 98.97 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 98.96 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 98.96 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 98.96 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.93 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.92 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 98.92 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 98.91 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 98.91 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 98.9 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 98.89 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 98.87 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 98.87 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.86 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 98.84 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.84 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 98.84 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.83 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 98.83 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.82 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 98.82 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.81 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 98.8 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 98.79 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.79 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 98.78 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 98.77 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.76 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 98.76 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 98.76 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.75 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.75 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 98.75 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.75 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.74 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 98.74 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 98.72 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.72 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.71 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.71 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.71 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 98.71 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 98.71 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 98.7 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.7 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.7 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 98.69 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 98.69 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 98.68 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.68 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.67 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.66 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 98.66 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.66 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.66 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 98.65 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.64 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 98.64 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 98.63 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 98.63 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.63 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 98.63 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 98.61 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.61 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.6 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 98.6 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 98.58 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.55 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.55 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 98.55 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.55 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 98.55 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 98.54 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 98.53 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.52 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 98.52 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 98.52 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.51 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.51 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 98.51 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 98.5 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 98.5 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 98.49 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 98.47 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 98.46 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 98.46 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 98.45 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 98.45 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.45 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 98.45 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 98.44 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 98.44 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.44 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 98.43 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 98.42 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 98.42 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.41 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 98.41 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 98.41 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 98.4 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 98.37 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 98.36 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 98.36 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.35 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.34 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.33 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 98.33 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 98.32 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 98.32 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 98.31 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 98.31 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 98.3 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 98.3 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 98.29 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.28 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 98.28 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 98.27 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 98.27 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 98.26 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 98.24 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 98.23 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 98.22 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 98.08 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.04 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.02 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 97.99 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 97.97 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 97.94 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 97.84 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 97.72 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.56 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 97.31 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.49 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 96.34 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 96.31 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 95.69 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 89.47 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 84.99 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 81.86 |
| >2lck_A Mitochondrial uncoupling protein 2; membrane protein, proton translocator, mitochondrial carrier transport protein, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.3e-47 Score=412.75 Aligned_cols=266 Identities=25% Similarity=0.361 Sum_probs=241.7
Q ss_pred HHHHHHHHHHHHHHhhhhHHHHHHHHhhCCC---------------ChHHHHHHhhhccccccccCcHHHHHHHHHHHHH
Q 003246 556 SALAGGLSCALSTSLMHPVDTIKTRVQASTL---------------TFPEIIAKLPQIGVRALYRGSIPAILGQFSSHGL 620 (836)
Q Consensus 556 ~~lAG~vAg~vs~~v~~PLD~IKtrlQ~~~~---------------~~~~i~~ilr~eGi~gLYRG~~~~ll~~~~~~~l 620 (836)
+++||++||+++.+++||||+||||+|++.. .++.+.+++++||++|||||+.+++++.++..++
T Consensus 4 ~~~aG~~ag~~~~~~~~Pld~iKtrlQ~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~eG~~glyrG~~~~l~~~~~~~~i 83 (303)
T 2lck_A 4 KFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQYRGVLGTILTMVRTEGPRSLYNGLVAGLQRQMSFASV 83 (303)
T ss_dssp HHHHHHHHHHHHHHTTHHHHHHHHHSSCCTTCCSHHHHCSCSSCSCHHHHHHHHHHHHCHHHHHSSHHHHHHHHHHHHHH
T ss_pred hHHhHHHHHHHHHHHcCcHHHHHHHHHhhhccccccccccCCCCCCHHHHHHHHHHhhCHHHHHcCCHHHHHHHHHHHHH
Confidence 6899999999999999999999999998742 2467788999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhcCCChhHHHHHHHHHHHHhhhhhcccCcHHHHHHHHHcC-------CCCCHHHHHHHHHHhcCccc
Q 003246 621 RTGIYEVSKLVLLNVAPNLQELQVQSISSFCSTFLGTAVRIPCEVLKQRLQAG-------LFNNVGEAIVGTWHQDGLKG 693 (836)
Q Consensus 621 ~f~~ye~lk~~l~~~~~~~~~~~~~~lag~~Ag~vs~~v~~PldvIKtRlQ~~-------~~~~~~~~l~~I~r~eGi~g 693 (836)
+|++|+.+|+.+.+... .......+++|++||+++.++++|+|+||+|+|++ .|.+.++++++|++++|++|
T Consensus 84 ~f~~ye~~k~~~~~~~~-~~~~~~~~~ag~~ag~~~~~~~~Pld~vktrlq~~~~~~~~~~~~~~~~~~~~i~~~eG~~g 162 (303)
T 2lck_A 84 RIGLYDSVKQFYTKGSE-HAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVEAYKTIAREEGIRG 162 (303)
T ss_dssp TTTHHHHHHHHHSCCCS-SCCHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHSCSCCCSSSCCCHHHHHHHHHHHHCHHH
T ss_pred HHHHHHHHHHHHhcCCc-CCcHHHHHHHHHHHHHHHHHHcCcHHHHHHHHhcccccCCCCCCCCHHHHHHHHHHhcChhh
Confidence 99999999998865422 24456778999999999999999999999999986 36899999999999999999
Q ss_pred ccccccccccccchhhhHHHHHHHHHHHHHHHhhCCCCChhHHHHHHHHHHHHHHHhhchHHHHHHHHHcCCCCCCCcHH
Q 003246 694 FFRGTGATLCREVPFYVVGTGLYGESKKMVQQLLGRELEPWETIFVGALSGGLTAVITTPFDVMKTRMMTAPQGRAATMS 773 (836)
Q Consensus 694 LYrG~~ptllr~vp~~~l~f~~Ye~lk~~l~~~~~~~~~~~~~~~aG~lAG~vas~it~PlDvIKtRlQ~~~~~~~~s~~ 773 (836)
||||+.|++++.+|+.+++|.+||.+++.+.+......+.+..+++|++||+++++++||+||||||||++....|.+++
T Consensus 163 lyrG~~~~l~~~~~~~~i~f~~ye~~k~~l~~~~~~~~~~~~~~~~g~~ag~~~~~~~~P~dvvktrlq~~~~~~y~~~~ 242 (303)
T 2lck_A 163 LWKGTSPNVARNAIVNCAELVTYDLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSALGQYHSAG 242 (303)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTTTSCCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSSSCCSHH
T ss_pred hhCCccHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCchHHHHHHHHHHHHHHHHHcCHHHHHHHHHHhccccccCCHH
Confidence 99999999999999999999999999998765433455677889999999999999999999999999998767799999
Q ss_pred HHHHHHHHhhCcccccccHHHHHHHHhhhHhhHHHHHHHHHHHHhhccc
Q 003246 774 MVAYTILRHEGPLGLFKGALPRFFWIAPLGAMNFAGYELAKKAMDKNDE 822 (836)
Q Consensus 774 ~~~~~I~r~eGl~gLYrG~~~~llr~~p~~ai~f~~YE~lk~~l~~~~~ 822 (836)
+|+++|+|+||++|||||+.|+++|.+|.++++|.+||.+|+++.+..+
T Consensus 243 ~~~~~i~~~eG~~glyrG~~~~~~r~~p~~~i~f~~ye~~k~~l~~~~~ 291 (303)
T 2lck_A 243 HCALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMAAYQ 291 (303)
T ss_dssp HHHHHHHHSSCTHHHHSCCHHHHHHHHHHHHHHHHHHHHHHSCCCCHHH
T ss_pred HHHHHHHHHcChHHhhccHHHHHHHHHhHHHHHHHHHHHHHHHHHHhcc
Confidence 9999999999999999999999999999999999999999998866543
|
| >1okc_A ADP, ATP carrier protein heart isoform T1; mitochondrial transporter, nucleotide translocation, membrane protein, transport; HET: CXT CDL LDM PC1; 2.2A {Bos taurus} SCOP: f.42.1.1 PDB: 2c3e_A* | Back alignment and structure |
|---|
| >1okc_A ADP, ATP carrier protein heart isoform T1; mitochondrial transporter, nucleotide translocation, membrane protein, transport; HET: CXT CDL LDM PC1; 2.2A {Bos taurus} SCOP: f.42.1.1 PDB: 2c3e_A* | Back alignment and structure |
|---|
| >2lck_A Mitochondrial uncoupling protein 2; membrane protein, proton translocator, mitochondrial carrier transport protein, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 836 | ||||
| d1okca_ | 292 | f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos ta | 1e-24 | |
| d1okca_ | 292 | f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos ta | 9e-05 | |
| d1ggwa_ | 140 | a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo | 9e-08 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 3e-07 | |
| d1y1xa_ | 182 | a.39.1.8 (A:) Programmed cell death 6 protein-like | 3e-06 | |
| d1w7jb1 | 139 | a.39.1.5 (B:11-149) Myosin Essential Chain {Human | 4e-06 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 5e-06 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 8e-06 | |
| d1m45a_ | 146 | a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye | 8e-06 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-05 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 3e-05 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 5e-05 | |
| d1jfja_ | 134 | a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly | 6e-05 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 6e-05 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 1e-04 | |
| d1df0a1 | 186 | a.39.1.8 (A:515-700) Calpain large subunit, C-term | 2e-04 | |
| d1wdcb_ | 142 | a.39.1.5 (B:) Myosin Essential Chain {Bay scallop | 2e-04 | |
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 4e-04 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 0.001 | |
| d1hqva_ | 181 | a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous | 0.001 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 0.001 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 0.001 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 0.001 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 0.002 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 0.003 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 0.004 |
| >d1okca_ f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos taurus), heart isoform t1 [TaxId: 9913]} Length = 292 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Mitochondrial carrier superfamily: Mitochondrial carrier family: Mitochondrial carrier domain: ADP,ATP carrier protein species: Cow (Bos taurus), heart isoform t1 [TaxId: 9913]
Score = 102 bits (255), Expect = 1e-24
Identities = 54/297 (18%), Positives = 98/297 (32%), Gaps = 48/297 (16%)
Query: 552 SVLKSALAGGLSCALSTSLMHPVDTIKTRVQASTLTFPEIIAKLPQIGVRALYRGSIPAI 611
S LK LAGG++ A+S + + P++ +K +Q + QI Y+G I +
Sbjct: 5 SFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHAS--------KQISAEKQYKGIIDCV 56
Query: 612 LGQFSSHGLRTGIYEVSKLVLLNV------------------------APNLQELQVQSI 647
+ G + V+ +
Sbjct: 57 VRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLA 116
Query: 648 SSFCSTFLGTAVRIPCEVLKQRLQA--------GLFNNVGEAIVGTWHQDGLKGFFRGTG 699
S + P + + RL A F +G I + DGL+G ++G
Sbjct: 117 SGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFN 176
Query: 700 ATLCREVPFYVVGTGLYGESKKMVQQLLGRELEPWETIFVGALSGGLTAVITTPFDVMKT 759
++ + + G+Y +K M+ + + + + + +++ PFD ++
Sbjct: 177 VSVQGIIIYRAAYFGVYDTAKGMLPD--PKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRR 234
Query: 760 RMMTAPQGRAA-----TMSMVAYTILRHEGPLGLFKGALPRFFWIAPLGAMNFAGYE 811
RMM + A I + EGP FKGA GA Y+
Sbjct: 235 RMMMQSGRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMG-GAFVLVLYD 290
|
| >d1okca_ f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos taurus), heart isoform t1 [TaxId: 9913]} Length = 292 | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 836 | |||
| d1okca_ | 292 | ADP,ATP carrier protein {Cow (Bos taurus), heart i | 100.0 | |
| d1okca_ | 292 | ADP,ATP carrier protein {Cow (Bos taurus), heart i | 99.92 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.75 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.74 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.72 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.72 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.71 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.71 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.7 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.69 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.69 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.68 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.67 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.67 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.67 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.66 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.62 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.61 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.6 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.6 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.57 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.57 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.56 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.54 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.54 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.54 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.53 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.51 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.51 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.51 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.51 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.51 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.5 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.47 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.47 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.45 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.44 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.44 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.43 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.42 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.38 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.37 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.35 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.31 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.27 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.26 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.26 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.22 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.21 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.19 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.17 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.15 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.14 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.13 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.13 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.13 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.12 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.1 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.1 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.09 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.08 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.08 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.07 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.07 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.06 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.05 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.05 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.05 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.04 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.04 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.03 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.01 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.01 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.01 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 98.99 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.98 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 98.98 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.98 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 98.96 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 98.96 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 98.96 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 98.96 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 98.95 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.94 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.93 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 98.92 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 98.88 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.87 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.87 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.85 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 98.85 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 98.84 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 98.82 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 98.81 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 98.8 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 98.79 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 98.77 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 98.76 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.74 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 98.72 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 98.72 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.72 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 98.68 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 98.68 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.64 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.56 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 98.56 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.54 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.51 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 98.48 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 98.46 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 98.44 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.44 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.44 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.44 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.43 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.39 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.38 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 98.37 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 98.34 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.31 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 98.31 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.27 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.24 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.22 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 98.21 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 98.2 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.17 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.17 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.17 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 98.16 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.14 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.13 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.11 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.11 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.08 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.07 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.07 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 97.95 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 97.9 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.87 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 97.8 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 97.78 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.65 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 97.4 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 97.34 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 97.21 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 97.05 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 96.93 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 96.91 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 96.8 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 96.72 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 96.59 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 96.43 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 95.24 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 94.42 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 94.23 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 87.73 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 87.42 |
| >d1okca_ f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos taurus), heart isoform t1 [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Mitochondrial carrier superfamily: Mitochondrial carrier family: Mitochondrial carrier domain: ADP,ATP carrier protein species: Cow (Bos taurus), heart isoform t1 [TaxId: 9913]
Probab=100.00 E-value=1.2e-41 Score=363.35 Aligned_cols=261 Identities=21% Similarity=0.336 Sum_probs=231.6
Q ss_pred hhhHHHHHHHHHHHHHHHHHhhhhHHHHHHHHhhCC------------CChHHHHHHhhhccccccccCcHHHHHHHHHH
Q 003246 550 AGSVLKSALAGGLSCALSTSLMHPVDTIKTRVQAST------------LTFPEIIAKLPQIGVRALYRGSIPAILGQFSS 617 (836)
Q Consensus 550 ~~~~l~~~lAG~vAg~vs~~v~~PLD~IKtrlQ~~~------------~~~~~i~~ilr~eGi~gLYRG~~~~ll~~~~~ 617 (836)
..+++++++||++||+++.+++||||+||||+|+++ +.++.+.++++++|+++||||+.+.+++..+.
T Consensus 3 ~~~~~~~~laG~~a~~i~~~~~~Pld~iK~r~Q~~~~~~~~~~~~~~~~~~~~~~~i~~~~G~~~ly~G~~~~l~~~~~~ 82 (292)
T d1okca_ 3 ALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT 82 (292)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHGGGCSSCCGGGSCCSHHHHHHHHHHHHCGGGGGTTTHHHHHHHHHH
T ss_pred CchHHHHHHHHHHHHHHHHHHhhHHHHHHHHHhcCCCCCCCCcccccCCHHHHHHHHHHhhhhhhhhhccchhhhhhhcc
Confidence 357899999999999999999999999999999964 22556788999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHhhcCCCh----hHHHHHHHHHHHHhhhhhcccCcHHHHHHHHHcC--------CCCCHHHHHHHH
Q 003246 618 HGLRTGIYEVSKLVLLNVAPNL----QELQVQSISSFCSTFLGTAVRIPCEVLKQRLQAG--------LFNNVGEAIVGT 685 (836)
Q Consensus 618 ~~l~f~~ye~lk~~l~~~~~~~----~~~~~~~lag~~Ag~vs~~v~~PldvIKtRlQ~~--------~~~~~~~~l~~I 685 (836)
.+++|++|+.++..+....... ......+++|.+|++++.++++|+|++|+|+|.+ .+.+..++++.+
T Consensus 83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~P~~~ik~r~~~~~~~~~~~~~~~~~~~~~~~~ 162 (292)
T d1okca_ 83 QALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKI 162 (292)
T ss_dssp HHHHHHHHHHHHHHHHTTCCTTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCSSTTTCSCSSHHHHHHHH
T ss_pred cchhHHHHHHHHHHHhcccccccccchhhhhhhhhhhhhhhhHHhhhhhhhhhheeeeccccccccccccccHHHHHHHh
Confidence 9999999999999988654332 2345567889999999999999999999999985 356799999999
Q ss_pred HHhcCcccccccccccccccchhhhHHHHHHHHHHHHHHHhhCCCCChhHHHHHHHHHHHHHHHhhchHHHHHHHHHcCC
Q 003246 686 WHQDGLKGFFRGTGATLCREVPFYVVGTGLYGESKKMVQQLLGRELEPWETIFVGALSGGLTAVITTPFDVMKTRMMTAP 765 (836)
Q Consensus 686 ~r~eGi~gLYrG~~ptllr~vp~~~l~f~~Ye~lk~~l~~~~~~~~~~~~~~~aG~lAG~vas~it~PlDvIKtRlQ~~~ 765 (836)
++++|+++||+|+.+++++.+|+++++|.+|+.+++.+.+. ........+++|++++++++++|||+||||||||++.
T Consensus 163 ~~~~G~~~l~~G~~~~~~~~~~~~~~~~~~~~~~k~~~~~~--~~~~~~~~~~~~~~~~~~a~~~t~P~dvvktR~q~~~ 240 (292)
T d1okca_ 163 FKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDP--KNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQS 240 (292)
T ss_dssp HHHHCHHHHTTTHHHHHHHHHHHHHHHHHHHHHHHHSSCGG--GCSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred hhccchhhhhccccccccceehHhhhhhhhccchhhhcccc--cccchHHHHHHHHHHHHHHhhccccHHHHHHHHHhcC
Confidence 99999999999999999999999999999999999865443 3456778899999999999999999999999999975
Q ss_pred CC-----CCCcHHHHHHHHHHhhCcccccccHHHHHHHHhhhHhhHHHHHHHH
Q 003246 766 QG-----RAATMSMVAYTILRHEGPLGLFKGALPRFFWIAPLGAMNFAGYELA 813 (836)
Q Consensus 766 ~~-----~~~s~~~~~~~I~r~eGl~gLYrG~~~~llr~~p~~ai~f~~YE~l 813 (836)
.. .|.++++++++|+|+||++|||||+.|+++|.+| .+++|.+||.+
T Consensus 241 ~~~~~~~~y~~~~~~~~~i~~~eG~~~lyrG~~~~~~r~i~-~~i~~~~ye~l 292 (292)
T d1okca_ 241 GRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMG-GAFVLVLYDEI 292 (292)
T ss_dssp TCCGGGCSCSSHHHHHHHHHHHHCGGGGGTTHHHHHHHHHH-HHHHHHHHHTC
T ss_pred CCCCCCCCCCCHHHHHHHHHHhcCcCcccccHHHHHHHHHH-HHhhhhHhhcC
Confidence 32 4779999999999999999999999999999766 68899999963
|
| >d1okca_ f.42.1.1 (A:) ADP,ATP carrier protein {Cow (Bos taurus), heart isoform t1 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|