Citrus Sinensis ID: 003290


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830---
MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNPKNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGMLLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALAYGIYKTDLPENDQLNVAFVDIGHASLQVCIAGFKKGQLKILGHSFDRSVGGRDFDEVLFQHFAAKFKEEYKIDVSQNARASLRLRVACEKLKKVLSANPEAPLNIECLMEEKDVRGFIKRDEFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRRTMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNETGDNQQSTTVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSEFERAKVKVKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDAAPPSSSETDVNMQDAKGTADAQGTTDAPGAENGVPESGDKPTQMETDKTPKKKVKKTNIPVSELVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFTSKLQETEDWLYEDGEDETKGVYVAKLEELKKQGDPIEERYKEFTDRSSVIDQLAYCINSYREAALSSDPKFDHIDIAEKQKVLNECADAEAWVREKKQQQDALPKYAAPVLLLGDVRRKAEALDRFCRPIMTKPKPAKPAAPETPATPPPQGGESQTNSGEANANQTENAQNATGEAPPASEEPMETEKTETTA
ccCEEEEcccccEEEEEEEcccEEECcccccccccccCEEcccccccccHHHHHHccccccccHHHHHHHcccccccHHHHHHHcccccEEEEcccccEEEEEEEcccEEcccHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHccccccEEccHHHHHHHHHccccccccccccEEEEEEEcccccEEEEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccEEEEEECcccccCEEECcccccccccccccccccCEECcccccccccCEEEEEEccccEEEEEEcccHHHHHcEEEEEEEEcccccEEcccccCEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEECccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNPKNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGMLLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALAYGIYKTDLPENDQLNVAFVDIGHASLQVCIAGFKKGQLKILGHSFDRSVGGRDFDEVLFQHFAAKFKEEYKIDVSQNARASLRLRVACEKLKKVLSANPEAPLNIECLMEEKDVRGFIKRDEFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRRTMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNET**NQQSTTVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSEFERAKVKVKVRLNMHGIVSIESATLLEEEEVEVP***************************************************************************KKTNIPVSELVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFTSKLQETEDWLYEDGEDETKGVYVAKLEELKKQGDPIEERYKEFTDRSSVIDQLAYCINSYREAALSSDPKFDHIDIAEKQKVLNECADAEAWVRE******ALPKYAAPVLLLGDVRRKAEALDRFCRPIM***************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVVGFDLGNESCIVAVARQRGIDVVLNDESKRETPSIVCFGDKQRFIGTAGAASSTMNPKNSISQIKRLIGRQFSDPELQRDLKSLPFAVTEGPDGYPLIHARYLGETRVFTPTQVLGMLLSNLKAIAESNLNAAVVDCCIGIPVYFTDLQRRAVIDAATIAGLHPLRLFHETTATALAYGIYKTDLPENDQLNVAFVDIGHASLQVCIAGFKKGQLKILGHSFDRSVGGRDFDEVLFQHFAAKFKEEYKIDVSQNARASLRLRVACEKLKKVLSANPEAPLNIECLMEEKDVRGFIKRDEFEQISAPILERVKRPLEKALAETGLSVEDVHMVEVVGSSSRVPAIIKILTEFFGKEPRRTMNASECVARGCALQCAILSPTFKVREFQVNESFPFSISLSWKGSAPEAQNETGDNQQSTTVFPKGNPIPSVKALTFYRSGTFTVDVQYADVSEFERAKVKVKVRLNMHGIVSIESATLLEEEEVEVPVTKEPEKEAAKMETDEVPSDAAPPSSSETDVNMQDAKGTADAQGTTDAPGAENGVPESGDKPTQMETDKTPKKKVKKTNIPVSELVYGGMLPVDVQKAVEKEFEMALQDRVMEETKDRKNAVEAYVYDMRNKLCDKYQDFVTDSERELFTSKLQETEDWLYEDGEDETKGVYVAKLEELKKQGDPIEERYKEFTDRSSVIDQLAYCINSYREAALSSDPKFDHIDIAEKQKVLNECADAEAWVREKKQQQDALPKYAAPVLLLGDVRRKAEALDRFCRPIMTKPKPAKPAAPETPATPPPQGGESQTNSGEANANQTENAQNATGEAPPASEEPMETEKTETTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock 70 kDa protein 15 In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.confidentF4HQD4
Heat shock 70 kDa protein 14 In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.confidentQ9S7C0
Heat shock protein 105 kDa Prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. Inhibits HSPA8/HSC70 ATPase and chaperone activities.probableQ92598

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D2F, chain A
Confidence level:very confident
Coverage over the Query: 1-482,560-691
View the alignment between query and template
View the model in PyMOL
Template: 3D2F, chain A
Confidence level:very confident
Coverage over the Query: 681-771
View the alignment between query and template
View the model in PyMOL