Citrus Sinensis ID: 003309

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830--

MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNERMQEYKRQIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQAPERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYHERQSRGSQQQRSCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKYAEKLFVRKPKDNQYLHSVAHQIWEGVRTNDKKAVYRHIVNFEVDVNAVYEQVSCISSLTLAKAMLLNEQTSLERSSSSLTGNSSDRSSSGSLNLAGTSEGQTMDDLEGCTLLHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLLLTRGADPRAVNREGKTSLELAVESNFADSEVLAILSDSHG

cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccEEEcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHcccc

****KLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYA**********************************************************************IRQGYL*****NLRGDWKRRFFVLDSRGMLYYYRK********************LGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLL*********************************************************************KPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQS*******************************SISVKEKFIHAKYAEKLFVRKPKDNQYLHSVAHQIWEGVRTNDKKAVYRHIVNFEVDVNAVYEQ*SCISSL***K***L*************TGNS*********************DLEGCTLLHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLLLTRGADPRAVNREGKTSLELAVESNFADSEVLAILSD***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MHFNKLDDSPMFRKQIQGLEESAEVLRERSLKFYKGCRKYTEGLGEGYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHMLNDRLLQYVNIDLHEVKEARKCFDKASLLYDQAREKFLSLRKGTKTDVAAILEEELHSARSAFEQARFSLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSxxxxxxxxxxxxxxxxxxxxxIDRESRWASNGSNGSPNGDGIQAIGRSSHKMIEAVMQSAAKGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKSSGSGSQLSSQRNSSELGSGLLSRWLSSHYHGGVHDEKSAARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQAPERCLPTSPMGSGHHRSASDSSSFESSDFDHAAVEEYTSERNLTSAYHERQSRGSQQQRSCVKSEKPIDVLRRVCGNDRCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVITLFQSLGNAFANSVWEELLQSRSAFHVDLTPPSLHKSDKPQLLLMGKPSHSDSISVKEKFIHAKYAEKLFVRKPKDNQYLHSVAHQIWEGVRTNDKKAVYRHIVNFEVDVNAVYEQVSCISSLTLAKAMLLNEQTSLERSSSSLTGNSSDRSSSGSLNLAGTSEGQTMDDLEGCTLLHLACDSADIGMLELLLQYGANINATDSRGLTPLHRCILRGKAMFAKLLLTRGADPRAVNREGKTSLELAVESNFADSEVLAILSDSHG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ADP-ribosylation factor GTPase-activating protein AGD3	GTPase-activating protein (GAP) for ADP ribosylation factor (ARF). Involved in the spatial control of provascular differentiation. Required for the formation of the normal pattern of continuous secondary veins. Involved in auxin signaling but not in polar auxin transport or in auxin responses. Required for PIN1 internalization in roots.	confident	Q5W7F2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 651-832
View the alignment between query and template
View the model in PyMOL

Template: 3JUE, chain A
Confidence level:very confident
Coverage over the Query: 499-589,611-642,680-683,707-831
View the alignment between query and template
View the model in PyMOL

Template: 2Q13, chain A
Confidence level:very confident
Coverage over the Query: 4-332,373-431
View the alignment between query and template
View the model in PyMOL

Template: 2FJL, chain A
Confidence level:confident
Coverage over the Query: 294-429
View the alignment between query and template
View the model in PyMOL