Citrus Sinensis ID: 003344


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------83
MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTNSPAKNLVSLNNTREGSSPLHPHSTSETSYSGIAGNGPGLDIARISLTSSEDRFSNSEERSMELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSELSNHSDASGEGKLESQPATTMRREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG
ccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHccccccccHHHHccccccHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHcccccccccccccccHHccccccHHHHHHHHcccccccccHHHHHHHHHHHcccccccHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccc
ccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEHHHccccEEEEccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHcccccccccccHHHHHHHHHHcHHHHHHHHHHcccHHHccccccccHHHHHHHHHHHHHHcHcccccccccHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHccccHcHHHHHHHHHHHHcccccccccHHHHHccHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHEEccccHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccc
MEISLLKVLLKKISSFlhlssfdsikLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSslqyfpgelsstsLELCSQKIKHMEYEQTSSLIKEAIRdqvdgvapsSEILVKVAESLSLRSNQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKqsqicspvpipsdfccplslelmtdpvivasGQTYERAFIKKWIDLglfvcpktrqtlahttlipnYTVKALIANWcelnnvklpdptktaslnqpsplfvhadsnaprdshifphtrgnqqimpestrstnspaknlvslnntregssplhphstsetsysgiagngpglDIARISLtssedrfsnseersmelvgqpsmsksikefpatidtseqsshihnrtASASSVLSnlnlsqgdanetselsnhsdasgegklesqpattmrrepefpsrvmetrsrsqviwrrpserfvprivstsgaetradlsGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSIndnnksaiananaiEPLIhvlqtgspeARENAAATLFSLSViednkikigrsgaigplvdllgngtprgkkDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLatipdgrvaigqengIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMvlqegavpplvalsqsgtpRAKEKAQALLSYFRNqrhgnagrg
MEISLLKVLLKKISSflhlssfdsikLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAeslslrsnqEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHtrgnqqimpestrstnspaKNLVSLNNTREGSSPLHPHSTSETSYSGIAGNGPGLDIARISLTSSedrfsnseersmelvgqpsmsKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETselsnhsdasgegklesqpattmrrepefpsrvmetrsrsqviwrrpserfvprivstsgaetradlsgieTQVRKLVEdlkstsldtqrEATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYfrnqrhgnagrg
MEIsllkvllkkissflHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTNSPAKNLVSLNNTREGSSPLHPHSTSETSYSGIAGNGPGLDIARISLTSSEDRFSNSEERSMELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTasassvlsnlnlsQGDANETSELSNHSDASGEGKLESQPATTMRREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSindnnksaiananaiEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG
***SLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEY*****LIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIEAVALE****************FMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKL***************************************************************************************************************************************************************************************************************************************************************ELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTG******NAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVA*******************************
***SLLKVLLKKISSFLHLSSF**I**DIVKKYYQRAEDILKLLKPILDAIVD**********KAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSL*************************************VKVAESLSL******************************FMDQMISLVTRMHD**************PIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCE*********************FVHADSNAPRDSHIFPHTR***************************************************G***********************ELVGQPSMSKSIKEFPATIDT*****************LSNLNLSQG****TSELSNHSDASGEGKLESQPAT**R**PEFPSRVME**********RPSERFVPRIVS***********GIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFR*Q********
MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQI**********PAKNLVSLNN******************SGIAGNGPGLDIARISLTSS********************SKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQ***********************************************VIWRRPSERFVPRIVSTSGAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQ**********QALLSYFRNQRHGNAGRG
*EISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHD***********SPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKL**********************************************TNSPAKNLVSLNNTREGSSPLHPHSTSETSYSGIAGNGPGLDIARISLTSSEDRFSNSEERSMELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSELSNHSDAS*EGKLESQPATTMRREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRN*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTNSPAKNLVSLNNTREGSSPLHPHSTSETSYSGIAGNGPGLDIARISLTSSEDRFSNSEERSMELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSELSNHSDASGEGKLESQPATTMRREPEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query828 2.2.26 [Sep-21-2011]
O22193826 U-box domain-containing p yes no 0.985 0.987 0.635 0.0
Q5XEZ8707 U-box domain-containing p no no 0.385 0.451 0.643 1e-114
Q8GWV5760 U-box domain-containing p no no 0.340 0.371 0.636 1e-94
Q5VRH9611 U-box domain-containing p no no 0.326 0.441 0.520 2e-70
Q9SNC6660 U-box domain-containing p no no 0.352 0.442 0.484 3e-69
Q8GUG9612 U-box domain-containing p no no 0.342 0.464 0.496 9e-67
Q8VZ40632 U-box domain-containing p no no 0.328 0.430 0.531 3e-65
Q9C9A6628 U-box domain-containing p no no 0.340 0.449 0.498 3e-63
Q9ZV31654 U-box domain-containing p no no 0.344 0.435 0.467 4e-63
Q0IMG9694 E3 ubiquitin-protein liga no no 0.326 0.389 0.490 4e-60
>sp|O22193|PUB4_ARATH U-box domain-containing protein 4 OS=Arabidopsis thaliana GN=PUB4 PE=1 SV=3 Back     alignment and function desciption
 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/833 (63%), Positives = 634/833 (76%), Gaps = 17/833 (2%)

Query: 6   LKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKA 65
           ++VLL+ ISSFL+LSS   I LD  +KYY+R E++L++LKPI D +V SD   DE L KA
Sbjct: 1   MEVLLRSISSFLNLSSSKHIDLDPFEKYYKRVEELLRVLKPIADVVVTSDFVFDEKLGKA 60

Query: 66  FEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGEL 125
           FEE  Q +D+  +L  +WQ   S+VYFVLQ+ESL+ K+R + +D    L SS  + P EL
Sbjct: 61  FEELTQDVDQSIDLFRSWQAFSSKVYFVLQIESLLPKMRDTIVDTFQFLMSSKNHLPDEL 120

Query: 126 SSTSLELCSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIE 185
           S  SLE C +KIKH+ YE+ SS+I  A+RDQ DGV PS EILVK+ E+  LRSNQEILIE
Sbjct: 121 SPASLEQCLEKIKHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQEILIE 180

Query: 186 AVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLS 245
           AVALE+ KE AEQ+E   E EF+DQ+I +V RMH+RL++IKQ+Q  S V I +DF CPLS
Sbjct: 181 AVALERQKEMAEQSENNAEVEFLDQLIVIVNRMHERLLLIKQTQTSS-VAILADFFCPLS 239

Query: 246 LELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCEL 305
           LE+MTDPVIV+SGQTYE+AFIK+WIDLGL VCPKTRQTL HTTLIPNYTVKALIANWCE 
Sbjct: 240 LEVMTDPVIVSSGQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCET 299

Query: 306 NNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQ-QIMPESTRSTNSPAKNL 364
           N+VKLPDP K+ SLN+ SPL    DS     + +      N+      S+  T  P+   
Sbjct: 300 NDVKLPDPNKSTSLNELSPLLSCTDSIPSTGADVSARKVSNKSHDWDASSSETGKPS--F 357

Query: 365 VSLNNTREGSSPLHPHSTSETSYSGIAGNGPGLDIARISLTSSEDRFSNSEERSMELVGQ 424
            S    REG+SP  P S    S  GI+GNG GLD  R SL   EDR ++S E   +  G+
Sbjct: 358 SSRATEREGASPSRPASALGASSPGISGNGYGLDARRGSLNDFEDRSNDSRELRTDAPGR 417

Query: 425 PSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQGDANETSELSNH-----SD 479
            S+S + +    +++  + S + H+R+ SA+S +SN    + DANE SE S H     SD
Sbjct: 418 SSVSSTTR---GSVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEESAHATPYSSD 474

Query: 480 ASGE---GKLESQPATTMRRE-PEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGAETR 535
           ASGE   G L +  +   RR+  +F  + M+ R+R Q  WRRPSER   RIVS    ETR
Sbjct: 475 ASGEIRSGPLAATTSAATRRDLSDFSPKFMDRRTRGQ-FWRRPSERLGSRIVSAPSNETR 533

Query: 536 ADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLH 595
            DLS +ETQV+KLVE+LKS+SLDTQR+ATAELRLLAKHNMDNR+VI N GAI +LV++L+
Sbjct: 534 RDLSEVETQVKKLVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLY 593

Query: 596 SSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSV 655
           S+++  QENAVTALLNLSINDNNK AIA+A AIEPLIHVL+ GS EA+EN+AATLFSLSV
Sbjct: 594 STDSATQENAVTALLNLSINDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSV 653

Query: 656 IEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVD 715
           IE+NKIKIG+SGAIGPLVDLLGNGTPRGKKDAATALFNLSI+ ENKA IVQ+GAV++L+D
Sbjct: 654 IEENKIKIGQSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLID 713

Query: 716 LMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQL 775
           LMDPAAGMVDKAVAVLANLATIP+GR AIGQE GIP+LVEVVELGSARGKENAAAALLQL
Sbjct: 714 LMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQL 773

Query: 776 CTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG 828
            TNS RFC+MVLQEGAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGRG
Sbjct: 774 STNSGRFCNMVLQEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG 826




Functions as an E3 ubiquitin ligase.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q5XEZ8|PUB2_ARATH U-box domain-containing protein 2 OS=Arabidopsis thaliana GN=PUB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8GWV5|PUB3_ARATH U-box domain-containing protein 3 OS=Arabidopsis thaliana GN=PUB3 PE=2 SV=2 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 Back     alignment and function description
>sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 Back     alignment and function description
>sp|Q8VZ40|PUB14_ARATH U-box domain-containing protein 14 OS=Arabidopsis thaliana GN=PUB14 PE=1 SV=1 Back     alignment and function description
>sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query828
224081810822 predicted protein [Populus trichocarpa] 0.974 0.981 0.728 0.0
359480587809 PREDICTED: U-box domain-containing prote 0.968 0.991 0.705 0.0
255567955799 ubiquitin-protein ligase, putative [Rici 0.920 0.953 0.692 0.0
356565898841 PREDICTED: U-box domain-containing prote 0.995 0.979 0.679 0.0
356539692838 PREDICTED: U-box domain-containing prote 0.995 0.983 0.681 0.0
449463969841 PREDICTED: U-box domain-containing prote 0.997 0.982 0.689 0.0
28974687790 arm repeat-containing protein [Nicotiana 0.948 0.993 0.657 0.0
297825203829 armadillo/beta-catenin repeat family pro 0.989 0.987 0.639 0.0
334184386826 RING/U-box domain and ARM repeat-contain 0.985 0.987 0.635 0.0
240254516829 RING/U-box domain and ARM repeat-contain 0.985 0.984 0.635 0.0
>gi|224081810|ref|XP_002306495.1| predicted protein [Populus trichocarpa] gi|222855944|gb|EEE93491.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1148 bits (2969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/843 (72%), Positives = 695/843 (82%), Gaps = 36/843 (4%)

Query: 1   MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDE 60
           MEISLL+VLLK IS+FLH+S  D I  D V+KYYQ+AE+ILKLLKPILD IV+S++ SD 
Sbjct: 1   MEISLLEVLLKNISAFLHISKDDKISSDPVQKYYQKAEEILKLLKPILDTIVNSEVPSDA 60

Query: 61  VLYKAFEEFGQSIDELRELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQY 120
           VL K F+E GQS+DEL+E+ ENWQPL S+V+FVLQ+ESL SKI + GL+    LK+S Q 
Sbjct: 61  VLNKDFQELGQSVDELKEIFENWQPLSSKVHFVLQIESLTSKICSLGLNSFQLLKASHQQ 120

Query: 121 FPGELSSTSLEL--CSQKIKHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRS 178
            P ELSS+SLE+  C QKIK   Y QTSS+IKEAI DQ +GV PSSEILVK+++SL LRS
Sbjct: 121 LPDELSSSSLEVFNCIQKIKLSGYVQTSSIIKEAISDQEEGVGPSSEILVKISDSLCLRS 180

Query: 179 NQEILIEAVALEKLKENAEQAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPS 238
           NQEILIEAVALEKLKENAEQAEK  EAEF+DQ+I+LVTRMH+RLV+IKQSQ  SPVPIP+
Sbjct: 181 NQEILIEAVALEKLKENAEQAEKTAEAEFIDQIITLVTRMHERLVLIKQSQTYSPVPIPA 240

Query: 239 DFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKAL 298
           DFCCPLSLELMTDPVIVASGQTYERAFIK WI+LGL VCPKT+QTLAHT LI NYTVKAL
Sbjct: 241 DFCCPLSLELMTDPVIVASGQTYERAFIKNWIELGLTVCPKTQQTLAHTNLITNYTVKAL 300

Query: 299 IANWCELNNVKLPDPTKTASLNQPSPLFVHADSNAPRDSHIFPHTRGNQQIMPESTRSTN 358
           IANWCE NNVKLPDP K+ S NQPSPL                       I  ES ++T 
Sbjct: 301 IANWCESNNVKLPDPIKSMSFNQPSPLL---------------------PISSESNQATG 339

Query: 359 SPAKNLVSLNNT-REGSSPLHPHSTSETSYSGIAGNGPGLDIARIS-LTSSEDRFSNSEE 416
           SP +N++S +   REGSSPLH HSTSE+S S I GNG GLDIARIS LTSSE+R SNSEE
Sbjct: 340 SPGQNMISSSGIQREGSSPLHSHSTSESSLSVIVGNGQGLDIARISSLTSSEERSSNSEE 399

Query: 417 RSMELVGQPSMSKSIKEFPATIDTSEQSSHIHNRTASASSVLSNLNLSQG---DANETSE 473
           R+++ V   S S S KE    +      S  HNR+ASASS L +    QG   DANE+SE
Sbjct: 400 RNLDSVHHCSASPSRKEVSTAVRADGLLSQNHNRSASASSALGHAAFPQGASGDANESSE 459

Query: 474 LSNH-----SDASGEGKLESQPATTMR---REPEFPSRVMETRSRSQVIWRRPSERFVPR 525
            SNH     SD SGE K E Q ++ +    REPEFPSR+++TRSRSQ IWRRPS+R VPR
Sbjct: 460 FSNHLTSYSSDISGEVKPEPQASSALHTPHREPEFPSRLVDTRSRSQTIWRRPSDRLVPR 519

Query: 526 IVSTSGAETRADLSGIETQVRKLVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCG 585
           IVS+S  ETRADL+GIET+VR LVEDLKST +DTQR+ATA+LRLLAKHNMDNR+VIAN G
Sbjct: 520 IVSSSAIETRADLAGIETEVRNLVEDLKSTLVDTQRDATAKLRLLAKHNMDNRIVIANFG 579

Query: 586 AINILVDMLHSSETKIQENAVTALLNLSINDNNKSAIANANAIEPLIHVLQTGSPEAREN 645
           AI++LV++L S++ KIQENAVTALLNLSINDNNK+AI NA+AIEPLIHVL+TGSPEA+EN
Sbjct: 580 AISLLVNLLRSTDIKIQENAVTALLNLSINDNNKTAIGNADAIEPLIHVLETGSPEAKEN 639

Query: 646 AAATLFSLSVIEDNKIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIV 705
           +AATLFSLSVIEDNK++IGRSGAI PLVDLLGNGTPRGKKDAATALFNLSI+HENK RIV
Sbjct: 640 SAATLFSLSVIEDNKVRIGRSGAIVPLVDLLGNGTPRGKKDAATALFNLSIFHENKDRIV 699

Query: 706 QAGAVKHLVDLMDPAAGMVDKAVAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGK 765
           QAGAVKHLV+LMDPAAGMVDKAVAVLANLATIP+GR AIGQE GIPVLVEVVELGSARGK
Sbjct: 700 QAGAVKHLVELMDPAAGMVDKAVAVLANLATIPEGRNAIGQEGGIPVLVEVVELGSARGK 759

Query: 766 ENAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNA 825
           ENAAAALLQLCTNSSRFC MVLQEGAVPPLVALSQSGTPRAKEKAQALLS+FRNQRHGNA
Sbjct: 760 ENAAAALLQLCTNSSRFCHMVLQEGAVPPLVALSQSGTPRAKEKAQALLSFFRNQRHGNA 819

Query: 826 GRG 828
           GR 
Sbjct: 820 GRA 822




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359480587|ref|XP_002283956.2| PREDICTED: U-box domain-containing protein 4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255567955|ref|XP_002524955.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223535790|gb|EEF37452.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356565898|ref|XP_003551173.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|356539692|ref|XP_003538329.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Back     alignment and taxonomy information
>gi|449463969|ref|XP_004149702.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] gi|449524872|ref|XP_004169445.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|28974687|gb|AAO61490.1| arm repeat-containing protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|297825203|ref|XP_002880484.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297326323|gb|EFH56743.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|334184386|ref|NP_001189583.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] gi|357529165|sp|O22193.3|PUB4_ARATH RecName: Full=U-box domain-containing protein 4; AltName: Full=Plant U-box protein 4 gi|330252324|gb|AEC07418.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|240254516|ref|NP_179895.6| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] gi|330252323|gb|AEC07417.1| RING/U-box domain and ARM repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query828
TAIR|locus:2045334829 PUB4 "plant U-box 4" [Arabidop 0.971 0.969 0.613 4.6e-247
TAIR|locus:2158252707 AT5G67340 [Arabidopsis thalian 0.431 0.504 0.567 2.8e-187
TAIR|locus:2102455760 AT3G54790 [Arabidopsis thalian 0.340 0.371 0.614 1.3e-141
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.322 0.436 0.5 3.8e-91
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.352 0.462 0.476 1e-90
TAIR|locus:2075140660 PUB13 "plant U-box 13" [Arabid 0.352 0.442 0.454 7.1e-90
TAIR|locus:2162276660 PUB15 "Plant U-Box 15" [Arabid 0.327 0.410 0.477 2.7e-86
TAIR|locus:2017719612 AT1G23030 [Arabidopsis thalian 0.342 0.464 0.472 7.2e-86
UNIPROTKB|Q0IMG9694 SPL11 "E3 ubiquitin-protein li 0.351 0.419 0.459 1.5e-85
TAIR|locus:2013990628 AT1G71020 [Arabidopsis thalian 0.340 0.449 0.477 7.4e-82
TAIR|locus:2045334 PUB4 "plant U-box 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2380 (842.9 bits), Expect = 4.6e-247, P = 4.6e-247
 Identities = 504/821 (61%), Positives = 604/821 (73%)

Query:    18 HLSSFDSIKLDIVKKYYQRAEDILKLLKPILDAIVDSDLASDEVLYKAFEEFGQSIDELR 77
             +LSS   I LD  +KYY+R E++L++LKPI D +V SD   DE L KAFEE  Q +D+  
Sbjct:    16 NLSSSKHIDLDPFEKYYKRVEELLRVLKPIADVVVTSDFVFDEKLGKAFEELTQDVDQSI 75

Query:    78 ELIENWQPLLSRVYFVLQVESLMSKIRTSGLDIMLQLKSSLQYFPGELSSTSLELCSQKI 137
             +L  +WQ   S+VYFVLQ+ESL+ K+R + +D    L SS  + P ELS  SLE C +KI
Sbjct:    76 DLFRSWQAFSSKVYFVLQIESLLPKMRDTIVDTFQFLMSSKNHLPDELSPASLEQCLEKI 135

Query:   138 KHMEYEQTSSLIKEAIRDQVDGVAPSSEILVKVAESLSLRSNQEILIEAVALEKLKENAE 197
             KH+ YE+ SS+I  A+RDQ DGV PS EILVK+ E+  LRSNQEILIEAVALE+ KE AE
Sbjct:   136 KHLSYEEISSVIDGALRDQRDGVGPSPEILVKIGENTGLRSNQEILIEAVALERQKEMAE 195

Query:   198 QAEKAGEAEFMDQMISLVTRMHDRLVMIKQSQICSPVPIPSDFCCPLSLELMTDPVIVAS 257
             Q+E   E EF+DQ+I +V RMH+RL++IKQ+Q  S V I +DF CPLSLE+MTDPVIV+S
Sbjct:   196 QSENNAEVEFLDQLIVIVNRMHERLLLIKQTQTSS-VAILADFFCPLSLEVMTDPVIVSS 254

Query:   258 GQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKALIANWCELNNVKLPDPTKTA 317
             GQTYE+AFIK+WIDLGL VCPKTRQTL HTTLIPNYTVKALIANWCE N+VKLPDP K+ 
Sbjct:   255 GQTYEKAFIKRWIDLGLKVCPKTRQTLTHTTLIPNYTVKALIANWCETNDVKLPDPNKST 314

Query:   318 SLNQPSPLFVHADSNAPRDSHIFPHTRGNQQI-MPESTRSTNSPAKNLVSLNNTREGSSP 376
             SLN+ SPL    DS     + +      N+      S+  T  P+ +  S    REG+SP
Sbjct:   315 SLNELSPLLSCTDSIPSTGADVSARKVSNKSHDWDASSSETGKPSFS--SRATEREGASP 372

Query:   377 LHPHSTSETSYSGIAGNGPGLDIARISLTSSEDRFSNSEERSMELVGQPSMSKSIKEFPA 436
               P S    S  GI+GNG GLD  R SL   EDR ++S E   +  G+ S+S + +    
Sbjct:   373 SRPASALGASSPGISGNGYGLDARRGSLNDFEDRSNDSRELRTDAPGRSSVSSTTR---G 429

Query:   437 TIDTSEQSSHIHNRTXXXXXXXXXXXXXQGDANETSELSNH-----SDASGE---GKLES 488
             +++  + S + H+R+             + DANE SE S H     SDASGE   G L +
Sbjct:   430 SVENGQTSENHHHRSPSATSTVSNEEFPRADANENSEESAHATPYSSDASGEIRSGPLAA 489

Query:   489 QPATTMRRE-PEFPSRVMETRSRSQVIWRRPSERFVPRIVSTSGAETRADLSGIETQVRK 547
               +   RR+  +F  + M+ R+R Q  WRRPSER   RIVS    ETR DLS +ETQV+K
Sbjct:   490 TTSAATRRDLSDFSPKFMDRRTRGQ-FWRRPSERLGSRIVSAPSNETRRDLSEVETQVKK 548

Query:   548 LVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVT 607
             LVE+LKS+SLDTQR+ATAELRLLAKHNMDNR+VI N GAI +LV++L+S+++  QENAVT
Sbjct:   549 LVEELKSSSLDTQRQATAELRLLAKHNMDNRIVIGNSGAIVLLVELLYSTDSATQENAVT 608

Query:   608 ALLNLSXXXXXXXXXXXXXXXEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIKIGRSG 667
             ALLNLS               EPLIHVL+ GS EA+EN+AATLFSLSVIE+NKIKIG+SG
Sbjct:   609 ALLNLSINDNNKKAIADAGAIEPLIHVLENGSSEAKENSAATLFSLSVIEENKIKIGQSG 668

Query:   668 AIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMVDKA 727
             AIGPLVDLLGNGTPRGKKDAATALFNLSI+ ENKA IVQ+GAV++L+DLMDPAAGMVDKA
Sbjct:   669 AIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLIDLMDPAAGMVDKA 728

Query:   728 VAVLANLATIPDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFCSMVL 787
             VAVLANLATIP+GR AIGQE GIP+LVEVVELGSARGKENAAAALLQL TNS RFC+MVL
Sbjct:   729 VAVLANLATIPEGRNAIGQEGGIPLLVEVVELGSARGKENAAAALLQLSTNSGRFCNMVL 788

Query:   788 QEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHGNAGRG 828
             QEGAVPPLVALSQSGTPRA+EKAQALLSYFRNQRHGNAGRG
Sbjct:   789 QEGAVPPLVALSQSGTPRAREKAQALLSYFRNQRHGNAGRG 829




GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005871 "kinesin complex" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA
GO:0019894 "kinesin binding" evidence=IEA
TAIR|locus:2158252 AT5G67340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102455 AT3G54790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162276 PUB15 "Plant U-Box 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IMG9 SPL11 "E3 ubiquitin-protein ligase SPL11" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O22193PUB4_ARATH6, ., 3, ., 2, ., -0.63500.98550.9878yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.4__246__AT2G23140.1
annotation not avaliable (829 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
smart0050463 smart00504, Ubox, Modified RING finger domain 3e-25
pfam0456473 pfam04564, U-box, U-box domain 7e-22
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-18
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-17
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-14
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 7e-14
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 8e-13
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-12
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-10
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-09
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-08
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 3e-07
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 1e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 2e-06
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 3e-06
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 6e-06
pfam05804 708 pfam05804, KAP, Kinesin-associated protein (KAP) 1e-05
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 8e-05
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 8e-05
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 3e-04
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 5e-04
COG5064 526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 6e-04
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 0.003
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 0.003
PLN03200 2102 PLN03200, PLN03200, cellulose synthase-interactive 0.004
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information
 Score = 98.8 bits (247), Expect = 3e-25
 Identities = 33/64 (51%), Positives = 42/64 (65%), Gaps = 1/64 (1%)

Query: 239 DFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTVKAL 298
           +F CP+SLE+M DPVI+ SGQTYER+ I+KW+       P T Q L H  LIPN  +K+ 
Sbjct: 1   EFLCPISLEVMKDPVILPSGQTYERSAIEKWLLSHGT-DPVTGQPLTHEDLIPNLALKSA 59

Query: 299 IANW 302
           I  W
Sbjct: 60  IQEW 63


Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63

>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|147776 pfam05804, KAP, Kinesin-associated protein (KAP) Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|215629 PLN03200, PLN03200, cellulose synthase-interactive protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 828
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.95
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.94
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.94
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.92
KOG4224 550 consensus Armadillo repeat protein VAC8 required f 99.92
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.89
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.89
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.86
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 99.85
PF05804708 KAP: Kinesin-associated protein (KAP) 99.77
KOG1048 717 consensus Neural adherens junction protein Plakoph 99.76
PF05804 708 KAP: Kinesin-associated protein (KAP) 99.74
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.68
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.66
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.61
KOG1048717 consensus Neural adherens junction protein Plakoph 99.52
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.51
KOG4199461 consensus Uncharacterized conserved protein [Funct 99.48
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.46
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 99.43
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.36
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.21
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 99.2
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 99.2
COG5113929 UFD2 Ubiquitin fusion degradation protein 2 [Postt 99.17
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.1
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.09
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.09
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.08
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.07
KOG4500 604 consensus Rho/Rac GTPase guanine nucleotide exchan 99.04
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.04
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 99.02
KOG1222 791 consensus Kinesin associated protein KAP [Intracel 98.99
PRK09687280 putative lyase; Provisional 98.95
PRK09687280 putative lyase; Provisional 98.89
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.89
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.88
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 98.85
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 98.84
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 98.75
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.74
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.72
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.63
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.59
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.55
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 98.54
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.51
KOG4646173 consensus Uncharacterized conserved protein, conta 98.5
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.5
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.49
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 98.45
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.45
KOG2973353 consensus Uncharacterized conserved protein [Funct 98.43
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.42
PHA02929238 N1R/p28-like protein; Provisional 98.41
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 98.41
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.4
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.39
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.37
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.35
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 98.28
KOG0289506 consensus mRNA splicing factor [General function p 98.27
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.26
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.2
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.19
KOG3678 832 consensus SARM protein (with sterile alpha and arm 98.18
KOG4646173 consensus Uncharacterized conserved protein, conta 98.17
KOG1293 678 consensus Proteins containing armadillo/beta-caten 98.12
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.12
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.11
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.08
KOG1293678 consensus Proteins containing armadillo/beta-caten 98.06
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 98.02
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.01
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 98.01
PF05536 543 Neurochondrin: Neurochondrin 97.99
PHA02926242 zinc finger-like protein; Provisional 97.97
KOG2973353 consensus Uncharacterized conserved protein [Funct 97.95
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 97.93
PTZ00429 746 beta-adaptin; Provisional 97.92
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.89
PTZ00429 746 beta-adaptin; Provisional 97.85
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.84
TIGR02270 410 conserved hypothetical protein. Members are found 97.83
COG5222427 Uncharacterized conserved protein, contains RING Z 97.82
PF1463444 zf-RING_5: zinc-RING finger domain 97.79
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 97.78
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.76
PF05536 543 Neurochondrin: Neurochondrin 97.73
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.73
KOG2734 536 consensus Uncharacterized conserved protein [Funct 97.68
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.63
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.6
KOG3678 832 consensus SARM protein (with sterile alpha and arm 97.56
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.55
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 97.5
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 97.49
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.49
KOG0297391 consensus TNF receptor-associated factor [Signal t 97.45
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.44
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 97.43
KOG4413 524 consensus 26S proteasome regulatory complex, subun 97.43
KOG2660331 consensus Locus-specific chromosome binding protei 97.41
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.38
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.36
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 97.34
COG5369743 Uncharacterized conserved protein [Function unknow 97.33
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.33
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 97.29
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 97.26
KOG2734536 consensus Uncharacterized conserved protein [Funct 97.18
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.13
TIGR02270 410 conserved hypothetical protein. Members are found 97.11
COG5369743 Uncharacterized conserved protein [Function unknow 97.09
KOG0212 675 consensus Uncharacterized conserved protein [Funct 97.08
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.0
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 96.95
COG1413335 FOG: HEAT repeat [Energy production and conversion 96.94
KOG17892235 consensus Endocytosis protein RME-8, contains DnaJ 96.88
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.81
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 96.79
KOG1242 569 consensus Protein containing adaptin N-terminal re 96.7
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.69
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.67
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 96.67
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 96.57
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 96.57
PF11841160 DUF3361: Domain of unknown function (DUF3361) 96.49
KOG4413 524 consensus 26S proteasome regulatory complex, subun 96.48
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 96.46
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 96.41
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 96.41
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 96.4
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.4
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.33
PF04641260 Rtf2: Rtf2 RING-finger 96.31
COG5152259 Uncharacterized conserved protein, contains RING a 96.28
KOG2979262 consensus Protein involved in DNA repair [General 96.19
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 96.18
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 96.16
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 96.14
KOG2259 823 consensus Uncharacterized conserved protein [Funct 96.1
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 96.08
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.05
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 96.02
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 95.99
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 95.98
PF05659147 RPW8: Arabidopsis broad-spectrum mildew resistance 95.96
KOG1242 569 consensus Protein containing adaptin N-terminal re 95.89
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 95.82
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 95.81
KOG1824 1233 consensus TATA-binding protein-interacting protein 95.79
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.77
KOG2259 823 consensus Uncharacterized conserved protein [Funct 95.75
KOG4367 699 consensus Predicted Zn-finger protein [Function un 95.74
KOG3036293 consensus Protein involved in cell differentiation 95.72
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.69
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.68
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 95.61
KOG3039303 consensus Uncharacterized conserved protein [Funct 95.56
PF11841160 DUF3361: Domain of unknown function (DUF3361) 95.52
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 95.52
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 95.51
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 95.49
COG5096 757 Vesicle coat complex, various subunits [Intracellu 95.38
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.22
PF05004309 IFRD: Interferon-related developmental regulator ( 95.2
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 95.18
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 94.95
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 94.92
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 94.9
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 94.86
KOG1824 1233 consensus TATA-binding protein-interacting protein 94.79
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 94.77
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 94.77
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 94.7
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 94.43
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 94.26
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 94.12
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 94.1
KOG3113293 consensus Uncharacterized conserved protein [Funct 93.99
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 93.98
PF05004309 IFRD: Interferon-related developmental regulator ( 93.98
KOG3036293 consensus Protein involved in cell differentiation 93.97
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 93.76
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 93.72
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.72
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 93.69
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 93.68
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 93.56
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 93.47
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 93.14
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.06
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 92.81
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 92.75
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 92.74
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 92.74
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 92.7
PF07814361 WAPL: Wings apart-like protein regulation of heter 92.56
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 92.39
KOG4151748 consensus Myosin assembly protein/sexual cycle pro 92.31
PF08045257 CDC14: Cell division control protein 14, SIN compo 92.22
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 91.94
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 91.94
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 91.93
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 91.64
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 91.51
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 91.29
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 91.25
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 91.18
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 91.02
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 91.02
KOG1001674 consensus Helicase-like transcription factor HLTF/ 90.99
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 90.87
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 90.78
KOG0825 1134 consensus PHD Zn-finger protein [General function 90.6
KOG0883518 consensus Cyclophilin type, U box-containing pepti 90.55
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 90.53
KOG0827465 consensus Predicted E3 ubiquitin ligase [Posttrans 90.15
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 90.05
KOG2999 713 consensus Regulator of Rac1, required for phagocyt 89.99
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 89.88
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 89.78
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 89.76
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 89.6
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 89.59
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 89.48
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 89.24
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 89.22
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 89.1
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 89.07
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 89.05
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 88.99
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 88.97
COG5109396 Uncharacterized conserved protein, contains RING Z 88.24
PF08045257 CDC14: Cell division control protein 14, SIN compo 88.2
KOG0567289 consensus HEAT repeat-containing protein [General 88.18
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 87.76
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 87.66
KOG2611 698 consensus Neurochondrin/leucine-rich protein (Neur 87.11
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 87.06
KOG0301745 consensus Phospholipase A2-activating protein (con 87.03
PF11701157 UNC45-central: Myosin-binding striated muscle asse 86.67
KOG1788 2799 consensus Uncharacterized conserved protein [Funct 86.58
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 86.37
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 85.81
COG5175480 MOT2 Transcriptional repressor [Transcription] 85.7
KOG0567289 consensus HEAT repeat-containing protein [General 85.57
KOG4653982 consensus Uncharacterized conserved protein [Funct 85.46
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 85.24
KOG4535728 consensus HEAT and armadillo repeat-containing pro 85.16
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 85.06
COG52191525 Uncharacterized conserved protein, contains RING Z 84.73
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 84.58
COG5627275 MMS21 DNA repair protein MMS21 [DNA replication, r 84.16
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 84.07
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 83.68
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 83.65
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 83.48
KOG0301745 consensus Phospholipase A2-activating protein (con 83.36
KOG4653982 consensus Uncharacterized conserved protein [Funct 83.17
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 83.11
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 82.8
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 82.8
KOG04141251 consensus Chromosome condensation complex Condensi 82.72
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 82.01
KOG149384 consensus Anaphase-promoting complex (APC), subuni 81.89
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 81.89
PF14500262 MMS19_N: Dos2-interacting transcription regulator 81.8
KOG2025 892 consensus Chromosome condensation complex Condensi 81.48
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 80.73
KOG0396389 consensus Uncharacterized conserved protein [Funct 80.18
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
Probab=99.95  E-value=1.6e-26  Score=291.08  Aligned_cols=280  Identities=24%  Similarity=0.286  Sum_probs=252.3

Q ss_pred             hhhHHHHHHHHhcCC--CHHHHHHHHHHHHHhhccChhhHHHHHh-cCcHHHHHHHHcCCCHHHHHHHHHHHHHhhcCCc
Q 003344          541 IETQVRKLVEDLKST--SLDTQREATAELRLLAKHNMDNRMVIAN-CGAINILVDMLHSSETKIQENAVTALLNLSINDN  617 (828)
Q Consensus       541 ~~~~V~~Lv~~L~s~--~~~~q~~Al~~L~~La~~s~~nr~~i~~-~GaI~~Lv~lL~s~d~~v~e~A~~aL~nLs~~~~  617 (828)
                      ....|..|++.|+++  +++.|..|+..|+.|++.+++||..|++ .|+||.|+.+|.+++..++++|+++|.||+.++.
T Consensus        11 ~~~~v~~Lve~L~s~~ss~~~~~~Al~~Lr~Lak~~~enR~~Ia~~aGaIP~LV~lL~sg~~~vk~nAaaaL~nLS~~e~   90 (2102)
T PLN03200         11 TLASVAQCIEQLRAKSSSPQEKELTTARLLELAKTREEARKAIGSHSQAMPLLVSLLRSGTLGAKVNAAAVLGVLCKEED   90 (2102)
T ss_pred             hHHHHHHHHHHHHcccCCHHHHHHHHHHHHHHHhcChHHHHHHHHccCcHHHHHHHHcCCCHHHHHHHHHHHHHHhcCHH
Confidence            467899999999977  7899999999999999999999999997 6999999999999999999999999999999999


Q ss_pred             cHHHHHHcCCHHHHHHhhcCCCHHHHHHHHHHHHHhccC---cchHHHHH-hhCChHHHHHhhcCCC---HHHHHHHHHH
Q 003344          618 NKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVI---EDNKIKIG-RSGAIGPLVDLLGNGT---PRGKKDAATA  690 (828)
Q Consensus       618 ~k~~I~~~g~l~~Lv~lL~s~~~e~~~~Aa~aL~nLS~~---~e~k~~I~-~~g~I~~Lv~LL~s~~---~~~~~~Al~a  690 (828)
                      ++..|+..|+|++|+.+|++|+.+.+++|+++|++|+.+   +.++..|+ ..|++|.|+++|++++   ..++..|+.+
T Consensus        91 nk~~Iv~~GaIppLV~LL~sGs~eaKe~AA~AL~sLS~~~~~D~~~~~I~v~~GaVp~Lv~lL~~gsk~d~~L~~~Av~A  170 (2102)
T PLN03200         91 LRVKVLLGGCIPPLLSLLKSGSAEAQKAAAEAIYAVSSGGLSDHVGSKIFSTEGVVPSLWDQLQPGNKQDKVVEGLLTGA  170 (2102)
T ss_pred             HHHHHHHcCChHHHHHHHHCCCHHHHHHHHHHHHHHHcCcchhhhhhhhhhhcCChHHHHHHHhCCchhhHHHHHHHHHH
Confidence            999999999999999999999999999999999999986   45565554 5799999999999974   2356677899


Q ss_pred             HHHchhcchhHHH-HHHhCcHHHHHHhc-CCChHHHHHHHHHHHHHhCC-chhHHHHHhCCcHHHHHHHHccC-CHHHHH
Q 003344          691 LFNLSIYHENKAR-IVQAGAVKHLVDLM-DPAAGMVDKAVAVLANLATI-PDGRVAIGQENGIPVLVEVVELG-SARGKE  766 (828)
Q Consensus       691 L~nLs~~~~n~~~-iv~~G~V~~Ll~LL-~~~~~v~~~Al~~LanLa~~-~e~r~~i~~~g~I~~Lv~lL~s~-s~~~ke  766 (828)
                      |+||+.+.+++.+ +++.|+|+.|+.+| +.+..++..|+++|.+++.+ ++++..+++.|+||.|+++|+++ ++.+|+
T Consensus       171 L~nLs~~~en~~~~IIeaGaVp~LV~LLsS~d~~lQ~eAa~aLa~Lass~ee~~~aVIeaGaVP~LV~LL~sg~~~~VRE  250 (2102)
T PLN03200        171 LRNLCGSTDGFWSATLEAGGVDILVKLLSSGNSDAQANAASLLARLMMAFESSISKVLDAGAVKQLLKLLGQGNEVSVRA  250 (2102)
T ss_pred             HHHHhcCccchHHHHHHcCCHHHHHHHHcCCCHHHHHHHHHHHHHHHcCChHHHHHHHHCCCHHHHHHHHccCCChHHHH
Confidence            9999999998865 58999999999999 56788899999999998874 77999999999999999999875 569999


Q ss_pred             HHHHHHHHHhhCCHHhHHHHHhCCCHHHHHHhhcCCC---------HHHHHHHHHHHHHhhcc
Q 003344          767 NAAAALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGT---------PRAKEKAQALLSYFRNQ  820 (828)
Q Consensus       767 ~Av~~L~~L~~~~~~~~~~v~~~g~v~~L~~LL~~g~---------~r~r~kA~~lL~~L~~~  820 (828)
                      +|+++|.+||.++.+++..+++.|+++.|+.++....         ...++.|.++|.++...
T Consensus       251 ~AA~AL~nLAs~s~e~r~~Iv~aGgIp~LI~lL~sp~~e~~~~~~~~~Lqe~AvwALsNIcgg  313 (2102)
T PLN03200        251 EAAGALEALSSQSKEAKQAIADAGGIPALINATVAPSKEFMQGEFAQALQENAMGALANICGG  313 (2102)
T ss_pred             HHHHHHHHHhcCCHHHHHHHHHCCCHHHHHHHHhCcchhhhccccchHHHHHHHHHHHHHhCC
Confidence            9999999999999999999999999999999998654         33589999999998763



>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5113 UFD2 Ubiquitin fusion degradation protein 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2973 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3678 consensus SARM protein (with sterile alpha and armadillo motifs) [Extracellular structures] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2979 consensus Protein involved in DNA repair [General function prediction only] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05659 RPW8: Arabidopsis broad-spectrum mildew resistance protein RPW8; InterPro: IPR008808 This entry represents the RPW8 domain found in several broad-spectrum mildew resistance proteins from Arabidopsis thaliana and other dicots Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG3036 consensus Protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0883 consensus Cyclophilin type, U box-containing peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2999 consensus Regulator of Rac1, required for phagocytosis and cell migration [Signal transduction mechanisms] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2611 consensus Neurochondrin/leucine-rich protein (Neurochondrin) [Function unknown] Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1788 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>KOG0396 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
1t1h_A78 Nmr Solution Structure Of The U Box Domain From Atp 3e-21
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 3e-11
2oxq_C80 Structure Of The Ubch5 :chip U-Box Complex Length = 4e-05
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 5e-05
2c2v_S78 Crystal Structure Of The Chip-Ubc13-Uev1a Complex L 1e-04
2f42_A179 Dimerization And U-Box Domains Of Zebrafish C-Termi 2e-04
1wa5_B 530 Crystal Structure Of The Exportin Cse1p Complexed W 7e-04
>pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 Back     alignment and structure

Iteration: 1

Score = 100 bits (249), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 43/74 (58%), Positives = 56/74 (75%) Query: 236 IPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTV 295 P F CP+SLELM DPVIV++GQTYER+ I+KW+D G CPK+++TL H L PNY + Sbjct: 5 FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVL 64 Query: 296 KALIANWCELNNVK 309 K+LIA WCE N ++ Sbjct: 65 KSLIALWCESNGIE 78
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure
>pdb|2OXQ|C Chain C, Structure Of The Ubch5 :chip U-Box Complex Length = 80 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|2C2V|S Chain S, Crystal Structure Of The Chip-Ubc13-Uev1a Complex Length = 78 Back     alignment and structure
>pdb|2F42|A Chain A, Dimerization And U-Box Domains Of Zebrafish C-Terminal Of Hsp70 Interacting Protein Length = 179 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query828
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-72
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 4e-39
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-26
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-09
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 2e-69
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-63
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-56
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 1e-56
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 3e-38
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 5e-29
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-66
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-62
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-56
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-52
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-44
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 6e-36
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-29
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-25
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-65
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-44
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-40
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 5e-40
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-30
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-64
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-56
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 4e-52
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-31
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 3e-26
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-61
3nmz_A458 APC variant protein; protein-protein complex, arma 8e-45
3nmz_A458 APC variant protein; protein-protein complex, arma 1e-38
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-36
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-29
3nmz_A 458 APC variant protein; protein-protein complex, arma 1e-24
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-60
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-41
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 1e-26
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 7e-09
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-55
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-40
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-31
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 4e-26
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 8e-47
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 3e-32
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 2e-23
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 9e-22
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 5e-43
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-40
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 6e-40
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 5e-26
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 4e-16
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 6e-43
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 6e-23
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 9e-23
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 4e-20
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-05
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-42
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 6e-24
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 5e-23
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 2e-05
2f42_A179 STIP1 homology and U-box containing protein 1; cha 3e-39
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 2e-38
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-36
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 2e-11
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 5e-08
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-35
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-33
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-19
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 1e-12
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 4e-05
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 2e-28
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 2e-28
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 9e-25
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 3e-24
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-21
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 3e-18
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 8e-21
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 9e-16
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 7e-15
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 4e-09
3opb_A 778 SWI5-dependent HO expression protein 4; heat and a 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 8e-12
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 2e-11
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 9e-12
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 3e-11
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 8e-09
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 5e-10
3grl_A 651 General vesicular transport factor P115; vesicle t 1e-08
3grl_A 651 General vesicular transport factor P115; vesicle t 1e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-08
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 3e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 3e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 1e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-07
1z6u_A150 NP95-like ring finger protein isoform B; structura 3e-06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 4e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 4e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 7e-06
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 1e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-04
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 5e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 5e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 5e-04
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
 Score =  236 bits (605), Expect = 2e-72
 Identities = 52/236 (22%), Positives = 117/236 (49%), Gaps = 5/236 (2%)

Query: 548 LVEDLKSTSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVT 607
           + + L S  +  Q  AT +   +     +    + + GA+  LV +L S   +I + A+ 
Sbjct: 17  MTQQLNSDDMQEQLSATRKFSQILSDGNEQIQAVIDAGALPALVQLLSSPNEQILQEALW 76

Query: 608 ALLNLSI-NDNNKSAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDNKIK-IGR 665
           AL N++   +    A+ +A A+  L+ +L + + +  + A   L +++   + +I+ +  
Sbjct: 77  ALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVID 136

Query: 666 SGAIGPLVDLLGNGTPRGKKDAATALFNLSIYH-ENKARIVQAGAVKHLVDLM-DPAAGM 723
           +GA+  LV LL +   +  ++A  AL N++    E    ++ AGA+  LV L+  P   +
Sbjct: 137 AGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQI 196

Query: 724 VDKAVAVLANLATI-PDGRVAIGQENGIPVLVEVVELGSARGKENAAAALLQLCTN 778
           + +A+  L+N+A+   + + A+ +   +  L ++    + + ++ A  AL +L ++
Sbjct: 197 LQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSH 252


>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Length = 98 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query828
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.96
3nmz_A458 APC variant protein; protein-protein complex, arma 99.96
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.96
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.95
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.95
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.95
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.95
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 99.95
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.95
3nmz_A458 APC variant protein; protein-protein complex, arma 99.94
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.94
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.93
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.93
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.93
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.92
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.92
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.92
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.91
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.91
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.91
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.91
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.89
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.89
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.89
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.88
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.88
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.86
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.86
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.86
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.86
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.85
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.85
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.84
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.84
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.83
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.83
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.8
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 99.79
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.77
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.77
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.76
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.76
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.73
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.58
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.58
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.52
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.47
3grl_A 651 General vesicular transport factor P115; vesicle t 99.46
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.43
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.37
3grl_A 651 General vesicular transport factor P115; vesicle t 99.33
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.31
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.31
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.3
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.29
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.29
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.28
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.27
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.26
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.26
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.26
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.26
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.25
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.25
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.23
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.21
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.2
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.18
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.17
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.15
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.15
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.14
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.14
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.13
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.12
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.11
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.06
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.01
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 98.98
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.97
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.96
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 98.96
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.94
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.9
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 98.9
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.88
2ect_A78 Ring finger protein 126; metal binding protein, st 98.84
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.83
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 98.83
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.79
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.76
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.75
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.73
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.72
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 98.71
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 98.7
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.7
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.69
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.67
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.65
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.61
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.61
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.59
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.58
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.53
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.52
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.45
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.4
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 98.39
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.39
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.36
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.35
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.3
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.29
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 98.28
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.26
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.26
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 98.25
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.25
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.23
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.17
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.16
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.06
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.02
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.02
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 97.98
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.96
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 97.91
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.89
2ea5_A68 Cell growth regulator with ring finger domain prot 97.85
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.84
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 97.76
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 97.73
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.71
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.64
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.63
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 97.58
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 97.58
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.58
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 97.53
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.52
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.4
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 97.38
2db0_A253 253AA long hypothetical protein; heat repeats, hel 97.31
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 97.2
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.17
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 96.7
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 96.3
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 96.29
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 96.29
2db0_A253 253AA long hypothetical protein; heat repeats, hel 96.24
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 96.11
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 96.02
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 95.98
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 95.65
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 95.41
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 95.21
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.01
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.65
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 94.64
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 94.45
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 94.24
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 94.17
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 93.96
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 93.92
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 93.37
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 92.35
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 92.12
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 91.41
2x1g_F 971 Cadmus; transport protein, developmental protein, 90.48
2x1g_F 971 Cadmus; transport protein, developmental protein, 89.84
2x19_B 963 Importin-13; nuclear transport, protein transport; 89.37
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 88.74
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 88.65
2x19_B 963 Importin-13; nuclear transport, protein transport; 87.98
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 87.88
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 87.62
3nw0_A238 Non-structural maintenance of chromosomes element 86.82
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 86.34
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 84.0
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 83.69
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 83.49
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 82.43
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 81.97
2kkx_A102 Uncharacterized protein ECS2156; methods developme 81.4
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 80.56
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 80.37
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
Probab=99.97  E-value=3.1e-29  Score=277.62  Aligned_cols=265  Identities=22%  Similarity=0.274  Sum_probs=238.3

Q ss_pred             HHHHHHHHHHHHhhccChhhHHHHHhcCcHHHHHHHHcC-----------CCHHHHHHHHHHHHHhhcCCc-cHHHHHHc
Q 003344          558 DTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHS-----------SETKIQENAVTALLNLSINDN-NKSAIANA  625 (828)
Q Consensus       558 ~~q~~Al~~L~~La~~s~~nr~~i~~~GaI~~Lv~lL~s-----------~d~~v~e~A~~aL~nLs~~~~-~k~~I~~~  625 (828)
                      ..+.+|++.|.+++.+ +++|..|++.|+++.|+.+|.+           .++.++++|+++|.||+.++. ++..+...
T Consensus        47 ~~~~~A~~aL~nls~d-~e~R~~i~~~G~l~~Lv~LL~~~~~~~~~~~~~~~~~~q~~Aa~aL~nLa~~~~~~k~~i~~~  125 (354)
T 3nmw_A           47 HQICPAVCVLMKLSFD-EEHRHAMNELGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSM  125 (354)
T ss_dssp             GTHHHHHHHHHHHHTS-HHHHHHHHHTTHHHHHHHHHHHHHHHHTTSCCHHHHHHHHHHHHHHHHHTSSCHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHcCC-HHHHHHHHHcCCHHHHHHHHhcccccccccCCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHHc
Confidence            4456899999999995 7999999999999999999953           246799999999999998765 77777654


Q ss_pred             -CCHHHHHHhhcCCCHHHHHHHHHHHHHhccC--cchHHHHHhhCChHHHHHhh-cCCCHHHHHHHHHHHHHchh-cchh
Q 003344          626 -NAIEPLIHVLQTGSPEARENAAATLFSLSVI--EDNKIKIGRSGAIGPLVDLL-GNGTPRGKKDAATALFNLSI-YHEN  700 (828)
Q Consensus       626 -g~l~~Lv~lL~s~~~e~~~~Aa~aL~nLS~~--~e~k~~I~~~g~I~~Lv~LL-~s~~~~~~~~Al~aL~nLs~-~~~n  700 (828)
                       |+|+.|+.+|++++.++++.|+++|.||+..  +++|..|++.|+|+.|+++| ++++..+++.|+.+|+||+. .+++
T Consensus       126 ~GaIp~LV~LL~s~~~~v~~~A~~aL~nLs~~~~~~~k~~i~~~G~Ip~Lv~lL~~~~~~~~~~~A~~aL~nLs~~~~~n  205 (354)
T 3nmw_A          126 KGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTEN  205 (354)
T ss_dssp             HHHHHHHHHGGGCSCHHHHHHHHHHHHHHHTTCCHHHHHHHHHTTHHHHHHHHHHHCCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             CCcHHHHHHHHCCCCHHHHHHHHHHHHHHhccCCHHHHHHHHHCCCHHHHHHHHhcCCCHHHHHHHHHHHHHHHccChhh
Confidence             6699999999999999999999999999984  57899999999999999975 66789999999999999999 6788


Q ss_pred             HHHHH-HhCcHHHHHHhcC-CCh----HHHHHHHHHHHHHhC----CchhHHHHHhCCcHHHHHHHHccCCHHHHHHHHH
Q 003344          701 KARIV-QAGAVKHLVDLMD-PAA----GMVDKAVAVLANLAT----IPDGRVAIGQENGIPVLVEVVELGSARGKENAAA  770 (828)
Q Consensus       701 ~~~iv-~~G~V~~Ll~LL~-~~~----~v~~~Al~~LanLa~----~~e~r~~i~~~g~I~~Lv~lL~s~s~~~ke~Av~  770 (828)
                      +..++ ..|+++.|+.+|. .+.    .+++.|+++|.||+.    ++++++.+.+.|+++.|+++|++++..++++|++
T Consensus       206 k~~i~~~~Gai~~Lv~lL~~~~~~~~~~v~~~A~~aL~nLs~~~a~~~~~~~~i~~~g~i~~Lv~lL~~~~~~v~~~A~~  285 (354)
T 3nmw_A          206 KADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACG  285 (354)
T ss_dssp             HHHHHHSTTHHHHHHHHTTCCCSSSCCHHHHHHHHHHHHHHHHHTTCHHHHHHHHTTTHHHHHHHHTTCSCHHHHHHHHH
T ss_pred             hHHHHHhcCcHHHHHHHhccCCCcccHHHHHHHHHHHHHHHhhccCCHHHHHHHHHcCCHHHHHHHHcCCChHHHHHHHH
Confidence            98888 7999999999993 222    589999999999995    8899999999999999999999999999999999


Q ss_pred             HHHHHhhCCHHhHHHHHhCCCHHHHHHhhcCCCHHHHHHHHHHHHHhhccccc
Q 003344          771 ALLQLCTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQRHG  823 (828)
Q Consensus       771 ~L~~L~~~~~~~~~~v~~~g~v~~L~~LL~~g~~r~r~kA~~lL~~L~~~~~~  823 (828)
                      +|+||+..+++.+..+++.|+++.|+.++.++++++++.|.++|++|......
T Consensus       286 aL~nLa~~~~~~~~~i~~~G~i~~Lv~LL~s~~~~i~~~A~~aL~nL~~~~~~  338 (354)
T 3nmw_A          286 TLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPA  338 (354)
T ss_dssp             HHHHHTSSCHHHHHHHHHTTHHHHHHTTTTCSSHHHHHHHHHHHHHHHTTCCG
T ss_pred             HHHHHhCCCHHHHHHHHHCCCHHHHHHHHhCCCHHHHHHHHHHHHHHHcCCHH
Confidence            99999988888999999999999999999999999999999999999876443



>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2kkx_A Uncharacterized protein ECS2156; methods development, U-box domain, structural genomics, PSI- protein structure initiative; NMR {Escherichia coli} PDB: 2kky_A Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 828
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 3e-22
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-22
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 5e-19
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 9e-19
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-18
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 8e-17
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-15
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 9e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 0.001
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-21
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-16
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 3e-16
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 8e-07
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-06
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 1e-17
d1wa5b_ 503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 3e-17
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 7e-08
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 6e-16
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 3e-09
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 6e-08
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-06
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 1e-05
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 2e-04
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 3e-11
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 5e-11
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 6e-11
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 1e-09
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 8e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 5e-07
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 5e-06
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 89.0 bits (220), Expect = 3e-22
 Identities = 43/74 (58%), Positives = 56/74 (75%)

Query: 236 IPSDFCCPLSLELMTDPVIVASGQTYERAFIKKWIDLGLFVCPKTRQTLAHTTLIPNYTV 295
            P  F CP+SLELM DPVIV++GQTYER+ I+KW+D G   CPK+++TL H  L PNY +
Sbjct: 5   FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGLTPNYVL 64

Query: 296 KALIANWCELNNVK 309
           K+LIA WCE N ++
Sbjct: 65  KSLIALWCESNGIE 78


>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query828
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.89
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.88
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1q1sc_ 434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.87
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.86
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.86
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.86
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.81
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.72
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.71
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.48
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.45
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.44
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.38
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.99
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.93
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.79
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.65
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.58
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.55
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 98.53
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.49
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.39
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.34
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.24
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.1
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 98.07
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.07
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.99
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.88
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.73
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 97.72
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 97.51
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 97.38
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.38
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.38
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.29
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 97.26
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.13
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.09
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.05
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 96.84
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 96.48
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 94.95
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 94.28
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 90.81
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 87.91
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 87.73
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.89  E-value=2e-21  Score=220.63  Aligned_cols=279  Identities=20%  Similarity=0.215  Sum_probs=249.8

Q ss_pred             hhHHHHHHHHhcC-CCHHHHHHHHHHHHHhhccChhhHHHHHhcCcHHHHHHHHcCCCHHHHHHHHHHHHHhhcC-CccH
Q 003344          542 ETQVRKLVEDLKS-TSLDTQREATAELRLLAKHNMDNRMVIANCGAINILVDMLHSSETKIQENAVTALLNLSIN-DNNK  619 (828)
Q Consensus       542 ~~~V~~Lv~~L~s-~~~~~q~~Al~~L~~La~~s~~nr~~i~~~GaI~~Lv~lL~s~d~~v~e~A~~aL~nLs~~-~~~k  619 (828)
                      .+.++.|++.++. .+.++|..|++.|.+++..+......+.+.|+++.|+.+|.+++.++++.|+++|.||+.+ +..+
T Consensus       118 ~g~i~~Lv~~l~~~~~~~iq~~a~~~L~ni~~~~~~~~~~~~~~g~i~~l~~lL~s~~~~i~~~a~~~L~nia~~~~~~r  197 (503)
T d1wa5b_         118 AGVVPRLVEFMRENQPEMLQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYR  197 (503)
T ss_dssp             TTCHHHHHHTTSTTSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCHHHH
T ss_pred             CCChHHHHHHHcCCCCHHHHHHHHHHHHHHHcCCHHHHHHHHhCCChHHHHHHhcCCChhHHHHHHHHHHHHhhhhHHHH
Confidence            4678999999984 5788999999999999998888888899999999999999999999999999999999875 5678


Q ss_pred             HHHHHcCCHHHHHHhhcCCCHHHHHHHHHHHHHhccCcch-HHHHHhhCChHHHHHhhcCCCHHHHHHHHHHHHHchhcc
Q 003344          620 SAIANANAIEPLIHVLQTGSPEARENAAATLFSLSVIEDN-KIKIGRSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYH  698 (828)
Q Consensus       620 ~~I~~~g~l~~Lv~lL~s~~~e~~~~Aa~aL~nLS~~~e~-k~~I~~~g~I~~Lv~LL~s~~~~~~~~Al~aL~nLs~~~  698 (828)
                      ..+.+.|++++|+.++.+....++.+++++|.+|+..... .......++++.|+.++.+.+.+++..++++|.+|+...
T Consensus       198 ~~l~~~~~~~~L~~ll~~~~~~~~~~~~~~l~nl~~~~~~~~~~~~~~~~l~~l~~~l~~~d~~~~~~~~~~l~~l~~~~  277 (503)
T d1wa5b_         198 DYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGP  277 (503)
T ss_dssp             HHHHHTTCHHHHHHGGGSCCHHHHHHHHHHHHHHHCCSSSCCCHHHHGGGHHHHHHHTTCCCHHHHHHHHHHHHHHHSSC
T ss_pred             HHHHhhcccccchhhcccCCHHHHHHHHHHHHHHhcCCccchHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhccCC
Confidence            8999999999999999999999999999999999975443 333445689999999999999999999999999999855


Q ss_pred             -hhHHHHHHhCcHHHHHHhc-CCChHHHHHHHHHHHHHhCCch-hHHHHHhCCcHHHHHHHHccCCHHHHHHHHHHHHHH
Q 003344          699 -ENKARIVQAGAVKHLVDLM-DPAAGMVDKAVAVLANLATIPD-GRVAIGQENGIPVLVEVVELGSARGKENAAAALLQL  775 (828)
Q Consensus       699 -~n~~~iv~~G~V~~Ll~LL-~~~~~v~~~Al~~LanLa~~~e-~r~~i~~~g~I~~Lv~lL~s~s~~~ke~Av~~L~~L  775 (828)
                       +....+++.|+++.|+.++ +++..+...|+.+|.+++...+ ....+.+.|+++.|..++.+.++.++..++++|.++
T Consensus       278 ~~~~~~~~~~~~~~~l~~ll~~~~~~v~~~al~~l~nl~~~~~~~~~~~~~~~~l~~l~~ll~~~~~~i~~~~~~~l~nl  357 (503)
T d1wa5b_         278 QEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNI  357 (503)
T ss_dssp             HHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHH
T ss_pred             chhhhhhhhhhhhhhhhhcccCCchhhhhhHHHHHHHHHHHHHHHHHhhhccchHHHHHHHhcCCCHHHHHHHHHHHHHH
Confidence             4557788999999999999 6778889999999999998554 455677889999999999999999999999999999


Q ss_pred             hhCCHHhHHHHHhCCCHHHHHHhhcCCCHHHHHHHHHHHHHhhcc
Q 003344          776 CTNSSRFCSMVLQEGAVPPLVALSQSGTPRAKEKAQALLSYFRNQ  820 (828)
Q Consensus       776 ~~~~~~~~~~v~~~g~v~~L~~LL~~g~~r~r~kA~~lL~~L~~~  820 (828)
                      +.+++.....+.+.|+++.|+.++.+++..++..|.++|.++...
T Consensus       358 ~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~~a~~~l~nl~~~  402 (503)
T d1wa5b_         358 TAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEACWAISNASSG  402 (503)
T ss_dssp             TTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHHHHHHHHHHHHHH
T ss_pred             hhccHHHHHHHHHccccchhHHhcccCChhHHHHHHHHHHHHHhc
Confidence            999998889999999999999999999999999999999888653



>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure