BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003362
         (826 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2K27|A Chain A, Solution Structure Of Human Pax8 Paired Box Domain
          Length = 159

 Score = 29.6 bits (65), Expect = 6.7,   Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 613 IRQGLIEPPKPKVKMSNLMKVLGSEATQDPTRLEKEIR 650
           IR G+I   KPKV    +++ +G    Q+PT    EIR
Sbjct: 71  IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIR 108


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.132    0.377 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 17,029,601
Number of Sequences: 62578
Number of extensions: 595299
Number of successful extensions: 986
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 985
Number of HSP's gapped (non-prelim): 9
length of query: 826
length of database: 14,973,337
effective HSP length: 107
effective length of query: 719
effective length of database: 8,277,491
effective search space: 5951516029
effective search space used: 5951516029
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 56 (26.2 bits)