Citrus Sinensis ID: 003378

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820----
MSSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETIGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
cccccccccEEEEEEECcccccccHHHHHHHHHHccccccccccccccccccHHHHHccccEEEcEEEEEEEEcHHHHcccccccccccEEEEEccccccccccHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHccccCEEEEEHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccEEECcccccEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHcccccccccccCEECcccccccccccEEEEEEHHHHHHHHHHHccccccHHHHHHHccccccHHHHHHccHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHccccccEEEEEEEEECccccccEEEEEEEEEcccccccEEEEEccccccccccccEEEEEEEEEEEcccCEEECcccccccEEEEccccccccccCEECcccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHcccccEEEEEcccccEEEEccccHHHHHHHHHHHHHHcccccEEEcccEEEEEEEcccccccEEEccccccccEEEEEEccccHHHHHHHHcccccccccHHHHHHHHHHHccccHHccccEEECccccccccEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHcccCEEEEEEEECcccccEEEEEEEEccccccccHHHHHHccccCECccccccEEEccccccccccHHHHHHHHHHHcccccccccccccccccc
***YCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMK****ELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIG*R**PKVRSKILSEEFGWDKDLAKKIWCFGPETIGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYCFTTISVCLGPDANSTFAGKSTLTDSLVAAAGIIAQEVAGDVRMTDTRQDEAERGITIKSTGISLYYEMTDAALKSYRGERQGNEYLINLIDSPGHVDFSSEVTAALRITDGALVVVDCIEGVCVQTETVLRQALGERIRPVLTVNKMDRCFLELQVDGEEAYQTFQKVIENANVIMATYEDPLLGDVQVYPEKGTVAFSAGLHGWAFTLTNFAKMYASKFGVDESKMMERLWGENFFDPATRKWTSRNTGSPTCKRGFVQFCYEPIKQIINICMNDEKDKLWPMLQKLGVTMKSEEKELMGKALMKRVMQTWLPASSALLEMMIFHLPSPATAQKYRVENLYEGPLDDAYANAIRNCDPEGPLMLYVSKMIPASDKGRFFAFGRVFSGKVATGLKVRIMGPNYVPGEKKDLYVKSVQRTVIWMGKKQETVEDVPCGNTVAMVGLDQYITKNATLTNEKEVDAHPIRAMKFSVSPVVRVAVQCKVASDLPKLVEGLKRLAKSDPMVVCSMEESGEHIIAGAGELHLEICLKDLQDDFMGGAEIIKSDPVVSFRETVLEKSCRTVMSKSPNKHNRLYMEARPLEEGLAEAIDDGRIGPRDDPKVRSKILSEEFGWDKDLAKKIWCFGPETIGPNMVVDMCKGVQYLNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPALGGIYSVLNQKRGHVFEEMQRPGTPLYNIKAYLPVVESFGFSSTLRAATSGQAFPQCVFDHWDMMSSDPLEPGSQASQLVLDIRKRKGLKEQMTPLSEYEDKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor 2 Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.confidentO23755
Elongation factor 2 Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.probableP09445
Elongation factor 2 Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.probableQ754C8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RDO, chain 7
Confidence level:very confident
Coverage over the Query: 6-41,63-183,195-210,227-588,630-803
View the alignment between query and template
View the model in PyMOL
Template: 1N0U, chain A
Confidence level:very confident
Coverage over the Query: 6-40,59-824
View the alignment between query and template
View the model in PyMOL