BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003405
         (823 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2XSN|A Chain A, Crystal Structure Of Human Tyrosine Hydroxylase Catalytic
           Domain
 pdb|2XSN|B Chain B, Crystal Structure Of Human Tyrosine Hydroxylase Catalytic
           Domain
 pdb|2XSN|C Chain C, Crystal Structure Of Human Tyrosine Hydroxylase Catalytic
           Domain
 pdb|2XSN|D Chain D, Crystal Structure Of Human Tyrosine Hydroxylase Catalytic
           Domain
          Length = 343

 Score = 30.0 bits (66), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 29/66 (43%), Gaps = 2/66 (3%)

Query: 540 EEILQKKNHYTALLELYKSNA--RHREALKLLHELVEESKSNQSQDEHTQKFNPESIIEY 597
           EEI   K  YT L  LY ++A   H EA  LL       + N  Q E   +F  E     
Sbjct: 66  EEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNIPQLEDVSRFLKERTGFQ 125

Query: 598 LKPLCG 603
           L+P+ G
Sbjct: 126 LRPVAG 131


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,884,183
Number of Sequences: 62578
Number of extensions: 775807
Number of successful extensions: 2106
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 2105
Number of HSP's gapped (non-prelim): 5
length of query: 823
length of database: 14,973,337
effective HSP length: 107
effective length of query: 716
effective length of database: 8,277,491
effective search space: 5926683556
effective search space used: 5926683556
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 56 (26.2 bits)