Query         003444
Match_columns 819
No_of_seqs    282 out of 1346
Neff          4.2 
Searched_HMMs 46136
Date          Thu Mar 28 23:31:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/003444.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/003444hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0082 G-protein alpha subuni 100.0   5E-71 1.1E-75  595.1  18.0  250  514-819    15-266 (354)
  2 KOG0085 G protein subunit Galp 100.0 1.1E-64 2.4E-69  516.9   2.1  265  491-819     5-270 (359)
  3 smart00275 G_alpha G protein a 100.0 6.1E-59 1.3E-63  501.8  18.4  252  513-819     2-255 (342)
  4 PF00503 G-alpha:  G-protein al 100.0 1.2E-58 2.6E-63  504.1  18.0  260  513-819    39-307 (389)
  5 KOG0099 G protein subunit Galp 100.0 4.3E-59 9.4E-64  481.9  11.7  256  508-819    16-273 (379)
  6 cd00066 G-alpha G protein alph 100.0 7.9E-57 1.7E-61  480.1  19.2  231  532-819     1-232 (317)
  7 PF00025 Arf:  ADP-ribosylation  98.5 3.7E-07   8E-12   89.9   8.5   73  717-818    46-118 (175)
  8 KOG0071 GTP-binding ADP-ribosy  98.5 1.6E-07 3.5E-12   92.1   5.8   62  744-818    60-121 (180)
  9 KOG0070 GTP-binding ADP-ribosy  98.3 1.3E-06 2.7E-11   88.6   6.7   61  745-818    61-121 (181)
 10 KOG0073 GTP-binding ADP-ribosy  98.0 7.7E-06 1.7E-10   82.1   5.4   60  745-817    60-119 (185)
 11 KOG0072 GTP-binding ADP-ribosy  97.9 1.7E-05 3.7E-10   78.5   6.7   89  714-815    26-119 (182)
 12 PLN00223 ADP-ribosylation fact  97.6 6.5E-05 1.4E-09   74.4   5.4   62  745-819    61-122 (181)
 13 KOG0074 GTP-binding ADP-ribosy  97.5  0.0001 2.2E-09   73.0   4.7   36  745-781    62-97  (185)
 14 smart00177 ARF ARF-like small   97.4 0.00028   6E-09   69.1   5.6   61  745-818    57-117 (175)
 15 cd04161 Arl2l1_Arl13_like Arl2  97.3 0.00035 7.5E-09   67.8   5.7   61  745-818    43-103 (167)
 16 cd04150 Arf1_5_like Arf1-Arf5-  97.3 0.00033 7.2E-09   67.4   5.3   61  745-818    44-104 (159)
 17 cd04149 Arf6 Arf6 subfamily.    97.2  0.0004 8.7E-09   67.7   5.3   61  745-818    53-113 (168)
 18 KOG0076 GTP-binding ADP-ribosy  97.2 0.00024 5.2E-09   72.3   3.1   61  745-818    69-129 (197)
 19 KOG0075 GTP-binding ADP-ribosy  97.1  0.0006 1.3E-08   68.0   5.1   60  745-817    65-124 (186)
 20 PTZ00133 ADP-ribosylation fact  97.1 0.00066 1.4E-08   67.2   5.4   61  745-818    61-121 (182)
 21 cd04158 ARD1 ARD1 subfamily.    97.1 0.00097 2.1E-08   64.6   6.4   61  745-818    43-103 (169)
 22 smart00178 SAR Sar1p-like memb  97.0  0.0011 2.3E-08   65.6   5.3   61  745-818    61-121 (184)
 23 cd04157 Arl6 Arl6 subfamily.    96.8  0.0021 4.5E-08   60.5   5.8   56  745-813    45-100 (162)
 24 cd04153 Arl5_Arl8 Arl5/Arl8 su  96.6   0.003 6.4E-08   61.6   5.5   61  745-818    59-119 (174)
 25 cd04160 Arfrp1 Arfrp1 subfamil  96.6  0.0033 7.2E-08   59.7   5.5   61  745-818    50-110 (167)
 26 cd00879 Sar1 Sar1 subfamily.    96.5  0.0037 8.1E-08   61.1   5.5   61  745-818    63-123 (190)
 27 KOG0077 Vesicle coat complex C  96.5  0.0012 2.6E-08   66.9   1.9   61  745-818    64-124 (193)
 28 cd04162 Arl9_Arfrp2_like Arl9/  96.3  0.0066 1.4E-07   58.9   5.9   37  745-782    44-80  (164)
 29 cd04151 Arl1 Arl1 subfamily.    96.3  0.0063 1.4E-07   57.8   5.3   37  745-782    43-79  (158)
 30 cd04156 ARLTS1 ARLTS1 subfamil  96.1    0.01 2.2E-07   56.0   5.6   61  745-818    44-104 (160)
 31 cd04154 Arl2 Arl2 subfamily.    96.1  0.0095 2.1E-07   57.7   5.5   36  745-781    58-93  (173)
 32 cd00878 Arf_Arl Arf (ADP-ribos  95.9   0.015 3.3E-07   54.8   6.0   61  745-818    43-103 (158)
 33 KOG0074 GTP-binding ADP-ribosy  95.7  0.0063 1.4E-07   60.7   2.6   34  527-561    13-52  (185)
 34 cd04175 Rap1 Rap1 subgroup.  T  95.3   0.032   7E-07   53.1   5.7   36  745-781    49-84  (164)
 35 cd04152 Arl4_Arl7 Arl4/Arl7 su  95.3   0.027 5.8E-07   55.6   5.3   37  745-782    52-88  (183)
 36 cd04176 Rap2 Rap2 subgroup.  T  95.2   0.043 9.3E-07   52.0   6.0   36  745-781    49-84  (163)
 37 cd04159 Arl10_like Arl10-like   95.0   0.043 9.2E-07   50.5   5.3   38  745-783    44-81  (159)
 38 cd04136 Rap_like Rap-like subf  94.7   0.065 1.4E-06   50.4   5.8   36  745-781    49-84  (163)
 39 PF00025 Arf:  ADP-ribosylation  94.6   0.026 5.7E-07   55.8   3.2   26  527-552    10-35  (175)
 40 cd04120 Rab12 Rab12 subfamily.  94.2   0.066 1.4E-06   54.9   5.0   37  745-782    49-85  (202)
 41 cd04155 Arl3 Arl3 subfamily.    94.0   0.035 7.5E-07   53.2   2.5   27  526-552     9-35  (173)
 42 cd01892 Miro2 Miro2 subfamily.  93.9   0.039 8.5E-07   53.8   2.6   24  528-551     1-24  (169)
 43 PTZ00099 rab6; Provisional      93.9     0.1 2.2E-06   52.2   5.5   36  745-781    29-64  (176)
 44 PF08477 Miro:  Miro-like prote  93.8    0.04 8.7E-07   49.8   2.4   35  747-782    52-86  (119)
 45 PF13207 AAA_17:  AAA domain; P  93.8   0.045 9.7E-07   49.9   2.7   24  533-556     1-24  (121)
 46 cd04143 Rhes_like Rhes_like su  93.6    0.11 2.5E-06   54.8   5.8   56  745-813    48-103 (247)
 47 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  93.6    0.13 2.7E-06   53.8   5.9   37  745-782    49-85  (222)
 48 cd01875 RhoG RhoG subfamily.    93.5    0.15 3.3E-06   50.9   6.1   37  745-782    51-87  (191)
 49 PRK08118 topology modulation p  93.3   0.052 1.1E-06   54.0   2.4   23  532-554     2-24  (167)
 50 cd00879 Sar1 Sar1 subfamily.    93.1    0.06 1.3E-06   52.7   2.5   24  529-552    17-40  (190)
 51 PRK07261 topology modulation p  93.1   0.057 1.2E-06   53.8   2.4   24  532-555     1-24  (171)
 52 cd04113 Rab4 Rab4 subfamily.    93.1   0.059 1.3E-06   51.0   2.3   21  532-552     1-21  (161)
 53 cd04141 Rit_Rin_Ric Rit/Rin/Ri  93.0     0.2 4.4E-06   49.1   6.0   36  745-781    50-85  (172)
 54 TIGR00231 small_GTP small GTP-  93.0   0.065 1.4E-06   48.5   2.4   22  531-552     1-22  (161)
 55 cd00154 Rab Rab family.  Rab G  93.0   0.063 1.4E-06   49.2   2.3   21  532-552     1-21  (159)
 56 cd04154 Arl2 Arl2 subfamily.    92.9   0.067 1.4E-06   51.8   2.4   26  527-552    10-35  (173)
 57 cd04138 H_N_K_Ras_like H-Ras/N  92.8    0.07 1.5E-06   49.8   2.4   22  531-552     1-22  (162)
 58 COG0563 Adk Adenylate kinase a  92.8   0.067 1.5E-06   54.3   2.4   21  532-552     1-21  (178)
 59 cd04155 Arl3 Arl3 subfamily.    92.8     0.2 4.2E-06   48.1   5.4   36  745-781    58-93  (173)
 60 cd00157 Rho Rho (Ras homology)  92.8    0.07 1.5E-06   50.6   2.3   20  532-551     1-20  (171)
 61 cd01874 Cdc42 Cdc42 subfamily.  92.7    0.17 3.8E-06   49.8   5.1   36  745-781    49-84  (175)
 62 PTZ00133 ADP-ribosylation fact  92.5   0.079 1.7E-06   52.6   2.5   24  529-552    15-38  (182)
 63 smart00175 RAB Rab subfamily o  92.3   0.089 1.9E-06   49.4   2.3   20  532-551     1-20  (164)
 64 cd04130 Wrch_1 Wrch-1 subfamil  92.2     0.3 6.4E-06   47.4   6.0   36  745-781    48-83  (173)
 65 cd01860 Rab5_related Rab5-rela  92.1    0.23   5E-06   46.9   4.9   37  745-782    50-86  (163)
 66 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  92.0    0.11 2.3E-06   49.6   2.6   21  531-551     2-22  (166)
 67 cd04150 Arf1_5_like Arf1-Arf5-  92.0   0.097 2.1E-06   50.4   2.3   21  532-552     1-21  (159)
 68 cd04144 Ras2 Ras2 subfamily.    92.0    0.21 4.5E-06   49.6   4.6   37  745-782    47-83  (190)
 69 cd01860 Rab5_related Rab5-rela  91.8    0.11 2.4E-06   49.1   2.4   22  531-552     1-22  (163)
 70 PF13671 AAA_33:  AAA domain; P  91.8    0.11 2.4E-06   48.5   2.4   19  534-552     2-20  (143)
 71 PF00071 Ras:  Ras family;  Int  91.8    0.12 2.6E-06   48.9   2.6   19  533-551     1-19  (162)
 72 smart00173 RAS Ras subfamily o  91.8    0.11 2.4E-06   49.2   2.3   21  532-552     1-21  (164)
 73 cd04105 SR_beta Signal recogni  91.8    0.14 3.1E-06   52.1   3.3   37  745-782    48-85  (203)
 74 PF01926 MMR_HSR1:  50S ribosom  91.7    0.12 2.7E-06   47.0   2.6   20  533-552     1-20  (116)
 75 cd04123 Rab21 Rab21 subfamily.  91.7    0.11 2.5E-06   48.4   2.3   21  532-552     1-21  (162)
 76 cd04139 RalA_RalB RalA/RalB su  91.7    0.11 2.4E-06   48.6   2.3   21  532-552     1-21  (164)
 77 PF13555 AAA_29:  P-loop contai  91.7    0.14   3E-06   44.2   2.6   23  534-556    26-48  (62)
 78 COG4639 Predicted kinase [Gene  91.7    0.32 6.8E-06   49.5   5.5   17  534-550     5-21  (168)
 79 PRK06217 hypothetical protein;  91.6    0.12 2.5E-06   51.6   2.4   25  532-556     2-26  (183)
 80 cd04115 Rab33B_Rab33A Rab33B/R  91.6    0.12 2.7E-06   49.8   2.5   23  530-552     1-23  (170)
 81 cd04121 Rab40 Rab40 subfamily.  91.6    0.16 3.4E-06   51.4   3.4   36  745-781    55-90  (189)
 82 cd04114 Rab30 Rab30 subfamily.  91.5    0.13 2.7E-06   49.1   2.5   24  529-552     5-28  (169)
 83 cd04160 Arfrp1 Arfrp1 subfamil  91.5    0.12 2.6E-06   49.1   2.3   24  533-556     1-24  (167)
 84 COG1100 GTPase SAR1 and relate  91.4    0.13 2.9E-06   51.3   2.6   22  531-552     5-26  (219)
 85 cd04127 Rab27A Rab27a subfamil  91.4    0.19 4.1E-06   48.6   3.6   36  745-781    63-98  (180)
 86 cd04135 Tc10 TC10 subfamily.    91.3    0.13 2.9E-06   49.2   2.5   21  532-552     1-21  (174)
 87 PLN00223 ADP-ribosylation fact  91.3    0.13 2.9E-06   51.1   2.4   24  529-552    15-38  (181)
 88 cd04106 Rab23_lke Rab23-like s  91.3    0.14   3E-06   48.3   2.4   21  532-552     1-21  (162)
 89 KOG0073 GTP-binding ADP-ribosy  91.2    0.16 3.5E-06   51.9   3.0   24  528-551    13-36  (185)
 90 cd01871 Rac1_like Rac1-like su  91.2    0.35 7.5E-06   47.6   5.3   37  745-782    49-85  (174)
 91 cd04138 H_N_K_Ras_like H-Ras/N  91.2    0.44 9.5E-06   44.4   5.7   36  745-781    49-84  (162)
 92 cd01861 Rab6 Rab6 subfamily.    91.2    0.14 3.1E-06   48.2   2.5   21  532-552     1-21  (161)
 93 smart00178 SAR Sar1p-like memb  91.1    0.15 3.1E-06   50.6   2.6   24  529-552    15-38  (184)
 94 cd04110 Rab35 Rab35 subfamily.  91.0    0.24 5.3E-06   49.6   4.1   36  745-781    55-90  (199)
 95 smart00177 ARF ARF-like small   90.9    0.15 3.3E-06   50.0   2.5   24  529-552    11-34  (175)
 96 cd04124 RabL2 RabL2 subfamily.  90.9    0.15 3.3E-06   48.9   2.4   21  532-552     1-21  (161)
 97 cd00876 Ras Ras family.  The R  90.9    0.14 3.1E-06   47.6   2.1   20  533-552     1-20  (160)
 98 cd04153 Arl5_Arl8 Arl5/Arl8 su  90.9    0.16 3.4E-06   49.7   2.4   23  530-552    14-36  (174)
 99 smart00173 RAS Ras subfamily o  90.8    0.45 9.7E-06   45.1   5.5   36  745-781    48-83  (164)
100 cd01865 Rab3 Rab3 subfamily.    90.8    0.16 3.5E-06   48.7   2.5   20  532-551     2-21  (165)
101 cd04133 Rop_like Rop subfamily  90.7    0.45 9.7E-06   47.6   5.6   36  745-781    49-84  (176)
102 cd04128 Spg1 Spg1p.  Spg1p (se  90.7    0.34 7.4E-06   48.3   4.7   38  745-783    49-86  (182)
103 PF13238 AAA_18:  AAA domain; P  90.7    0.18   4E-06   45.7   2.6   19  534-552     1-19  (129)
104 cd04136 Rap_like Rap-like subf  90.7    0.17 3.7E-06   47.6   2.5   21  532-552     2-22  (163)
105 cd01864 Rab19 Rab19 subfamily.  90.6    0.19 4.1E-06   48.0   2.7   21  531-551     3-23  (165)
106 cd04141 Rit_Rin_Ric Rit/Rin/Ri  90.6    0.18 3.9E-06   49.4   2.7   23  530-552     1-23  (172)
107 cd04117 Rab15 Rab15 subfamily.  90.6    0.17 3.7E-06   48.6   2.4   21  532-552     1-21  (161)
108 cd04119 RJL RJL (RabJ-Like) su  90.6    0.18 3.9E-06   47.4   2.5   21  532-552     1-21  (168)
109 cd01868 Rab11_like Rab11-like.  90.5    0.18 3.9E-06   48.0   2.5   21  531-551     3-23  (165)
110 cd04116 Rab9 Rab9 subfamily.    90.5    0.19 4.1E-06   48.1   2.6   23  530-552     4-26  (170)
111 cd04177 RSR1 RSR1 subgroup.  R  90.4    0.18 3.9E-06   48.5   2.4   22  531-552     1-22  (168)
112 cd04124 RabL2 RabL2 subfamily.  90.4    0.38 8.2E-06   46.2   4.6   37  745-782    49-85  (161)
113 cd04149 Arf6 Arf6 subfamily.    90.3    0.18 3.9E-06   49.3   2.3   24  529-552     7-30  (168)
114 cd04122 Rab14 Rab14 subfamily.  90.3    0.32   7E-06   46.6   4.0   36  745-781    51-86  (166)
115 cd04127 Rab27A Rab27a subfamil  90.3     0.2 4.4E-06   48.4   2.6   22  530-551     3-24  (180)
116 cd01895 EngA2 EngA2 subfamily.  90.2    0.19 4.2E-06   47.0   2.4   21  531-551     2-22  (174)
117 cd04147 Ras_dva Ras-dva subfam  90.2    0.36 7.8E-06   48.3   4.4   36  745-781    47-82  (198)
118 cd01862 Rab7 Rab7 subfamily.    90.2    0.19 4.1E-06   47.7   2.3   20  532-551     1-20  (172)
119 cd04107 Rab32_Rab38 Rab38/Rab3  90.2    0.36 7.8E-06   48.3   4.4   36  745-781    50-85  (201)
120 cd04107 Rab32_Rab38 Rab38/Rab3  90.1    0.19 4.2E-06   50.3   2.4   21  532-552     1-21  (201)
121 cd01892 Miro2 Miro2 subfamily.  90.1     0.5 1.1E-05   46.1   5.2   37  745-782    54-90  (169)
122 cd04151 Arl1 Arl1 subfamily.    90.0    0.19   4E-06   47.8   2.2   20  533-552     1-20  (158)
123 cd04140 ARHI_like ARHI subfami  90.0     0.2 4.4E-06   48.0   2.4   20  532-551     2-21  (165)
124 cd04117 Rab15 Rab15 subfamily.  90.0    0.57 1.2E-05   45.1   5.5   36  745-781    49-84  (161)
125 cd04145 M_R_Ras_like M-Ras/R-R  90.0    0.21 4.6E-06   47.0   2.5   21  531-551     2-22  (164)
126 cd04103 Centaurin_gamma Centau  90.0    0.21 4.5E-06   48.6   2.4   21  532-552     1-21  (158)
127 PF00005 ABC_tran:  ABC transpo  89.9    0.23 4.9E-06   46.3   2.6   22  531-552    11-32  (137)
128 cd04112 Rab26 Rab26 subfamily.  89.9     0.2 4.3E-06   49.8   2.3   20  532-551     1-20  (191)
129 cd04137 RheB Rheb (Ras Homolog  89.9    0.22 4.8E-06   48.2   2.5   21  532-552     2-22  (180)
130 cd04134 Rho3 Rho3 subfamily.    89.8    0.22 4.7E-06   49.5   2.5   21  532-552     1-21  (189)
131 cd04163 Era Era subfamily.  Er  89.8    0.24 5.2E-06   45.7   2.6   22  530-551     2-23  (168)
132 PTZ00132 GTP-binding nuclear p  89.8     0.2 4.3E-06   50.7   2.3   23  529-551     7-29  (215)
133 cd04101 RabL4 RabL4 (Rab-like4  89.8    0.35 7.6E-06   45.8   3.8   37  745-782    52-88  (164)
134 cd01893 Miro1 Miro1 subfamily.  89.8    0.21 4.6E-06   48.0   2.3   21  532-552     1-21  (166)
135 cd04122 Rab14 Rab14 subfamily.  89.7    0.22 4.9E-06   47.7   2.5   22  531-552     2-23  (166)
136 cd01863 Rab18 Rab18 subfamily.  89.7    0.22 4.7E-06   47.0   2.3   21  532-552     1-21  (161)
137 smart00382 AAA ATPases associa  89.6    0.24 5.1E-06   43.7   2.3   25  532-556     3-27  (148)
138 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  89.6    0.46   1E-05   47.7   4.7   37  745-782    53-89  (182)
139 TIGR02322 phosphon_PhnN phosph  89.6    0.21 4.6E-06   49.1   2.2   24  533-556     3-26  (179)
140 PLN03108 Rab family protein; P  89.6    0.23   5E-06   50.5   2.6   23  530-552     5-27  (210)
141 cd04101 RabL4 RabL4 (Rab-like4  89.6    0.24 5.1E-06   46.9   2.4   20  532-551     1-20  (164)
142 PRK10078 ribose 1,5-bisphospho  89.6    0.21 4.6E-06   49.9   2.2   24  533-556     4-27  (186)
143 cd01867 Rab8_Rab10_Rab13_like   89.5    0.24 5.2E-06   47.6   2.5   22  531-552     3-24  (167)
144 cd04110 Rab35 Rab35 subfamily.  89.5    0.24 5.3E-06   49.7   2.6   23  530-552     5-27  (199)
145 PTZ00369 Ras-like protein; Pro  89.5    0.48   1E-05   47.0   4.7   37  745-782    53-89  (189)
146 cd04129 Rho2 Rho2 subfamily.    89.5    0.23 5.1E-06   49.1   2.5   21  532-552     2-22  (187)
147 cd01870 RhoA_like RhoA-like su  89.4    0.25 5.4E-06   47.4   2.5   20  532-551     2-21  (175)
148 cd04158 ARD1 ARD1 subfamily.    89.4    0.22 4.9E-06   48.2   2.2   20  533-552     1-20  (169)
149 cd01874 Cdc42 Cdc42 subfamily.  89.3    0.26 5.7E-06   48.5   2.6   22  531-552     1-22  (175)
150 cd01876 YihA_EngB The YihA (En  89.3    0.23 5.1E-06   46.0   2.1   20  533-552     1-20  (170)
151 cd04164 trmE TrmE (MnmE, ThdF,  89.2    0.26 5.6E-06   45.6   2.4   21  532-552     2-22  (157)
152 cd01878 HflX HflX subfamily.    89.2     0.2 4.4E-06   49.9   1.7   21  531-551    41-61  (204)
153 cd04125 RabA_like RabA-like su  89.2    0.25 5.3E-06   48.7   2.3   21  532-552     1-21  (188)
154 COG4619 ABC-type uncharacteriz  89.1    0.35 7.5E-06   50.2   3.3   27  531-557    29-55  (223)
155 cd04118 Rab24 Rab24 subfamily.  89.1    0.25 5.5E-06   48.6   2.3   21  532-552     1-21  (193)
156 cd01865 Rab3 Rab3 subfamily.    89.1    0.44 9.5E-06   45.7   3.9   36  745-781    50-85  (165)
157 smart00176 RAN Ran (Ras-relate  88.9    0.67 1.4E-05   47.5   5.3   38  745-783    44-81  (200)
158 cd04108 Rab36_Rab34 Rab34/Rab3  88.8    0.75 1.6E-05   45.0   5.4   36  745-781    49-84  (170)
159 cd04175 Rap1 Rap1 subgroup.  T  88.8    0.28 6.1E-06   46.7   2.4   22  531-552     1-22  (164)
160 cd02021 GntK Gluconate kinase   88.8    0.27 5.8E-06   46.9   2.2   21  534-554     2-22  (150)
161 PRK03839 putative kinase; Prov  88.8    0.27 5.9E-06   48.5   2.3   24  533-556     2-25  (180)
162 cd00877 Ran Ran (Ras-related n  88.8    0.28   6E-06   47.7   2.3   21  532-552     1-21  (166)
163 cd04132 Rho4_like Rho4-like su  88.7    0.28   6E-06   47.9   2.3   21  532-552     1-21  (187)
164 cd04159 Arl10_like Arl10-like   88.7    0.28 6.1E-06   45.1   2.2   20  533-552     1-20  (159)
165 cd04156 ARLTS1 ARLTS1 subfamil  88.7    0.27   6E-06   46.3   2.2   20  533-552     1-20  (160)
166 cd01866 Rab2 Rab2 subfamily.    88.7     0.3 6.5E-06   47.1   2.5   22  531-552     4-25  (168)
167 TIGR03598 GTPase_YsxC ribosome  88.5     0.3 6.5E-06   48.0   2.4   25  528-552    15-39  (179)
168 cd03243 ABC_MutS_homologs The   88.3    0.31 6.8E-06   49.3   2.5   21  532-552    30-50  (202)
169 TIGR03263 guanyl_kin guanylate  88.2     0.3 6.5E-06   47.8   2.2   22  533-554     3-24  (180)
170 cd04145 M_R_Ras_like M-Ras/R-R  88.2     0.6 1.3E-05   44.0   4.2   36  745-781    50-85  (164)
171 cd04152 Arl4_Arl7 Arl4/Arl7 su  88.2    0.33   7E-06   48.0   2.4   21  531-551     3-23  (183)
172 PRK14532 adenylate kinase; Pro  88.2    0.32   7E-06   48.3   2.4   23  533-555     2-24  (188)
173 cd03274 ABC_SMC4_euk Eukaryoti  88.1    0.45 9.7E-06   49.2   3.5   23  534-556    28-50  (212)
174 PLN03071 GTP-binding nuclear p  88.1    0.98 2.1E-05   46.5   5.9   37  745-782    62-98  (219)
175 cd01863 Rab18 Rab18 subfamily.  88.1     0.7 1.5E-05   43.6   4.5   36  745-781    49-84  (161)
176 cd04176 Rap2 Rap2 subgroup.  T  88.0    0.36 7.8E-06   45.8   2.6   21  531-551     1-21  (163)
177 cd03283 ABC_MutS-like MutS-lik  87.9    0.32   7E-06   49.8   2.3   21  533-553    27-47  (199)
178 cd04161 Arl2l1_Arl13_like Arl2  87.9    0.33 7.1E-06   47.2   2.2   20  533-552     1-20  (167)
179 TIGR02528 EutP ethanolamine ut  87.9    0.35 7.6E-06   45.0   2.3   19  533-551     2-20  (142)
180 cd01428 ADK Adenylate kinase (  87.8    0.33 7.1E-06   47.8   2.2   24  533-556     1-24  (194)
181 PRK13949 shikimate kinase; Pro  87.8    0.35 7.5E-06   48.3   2.4   20  533-552     3-22  (169)
182 COG1136 SalX ABC-type antimicr  87.7    0.52 1.1E-05   50.1   3.7   38  533-570    33-82  (226)
183 PTZ00369 Ras-like protein; Pro  87.7    0.39 8.5E-06   47.6   2.6   23  530-552     4-26  (189)
184 cd04157 Arl6 Arl6 subfamily.    87.7    0.35 7.5E-06   45.5   2.2   20  533-552     1-20  (162)
185 TIGR01313 therm_gnt_kin carboh  87.6     0.3 6.6E-06   47.2   1.8   21  534-554     1-21  (163)
186 PF13521 AAA_28:  AAA domain; P  87.6     0.3 6.5E-06   47.5   1.8   22  533-554     1-22  (163)
187 cd04130 Wrch_1 Wrch-1 subfamil  87.6    0.37   8E-06   46.7   2.3   20  532-551     1-20  (173)
188 cd04131 Rnd Rnd subfamily.  Th  87.5    0.88 1.9E-05   45.3   5.0   36  745-781    49-84  (178)
189 PF05729 NACHT:  NACHT domain    87.4    0.39 8.4E-06   45.2   2.3   18  534-551     3-20  (166)
190 cd01875 RhoG RhoG subfamily.    87.4    0.43 9.2E-06   47.7   2.7   22  531-552     3-24  (191)
191 cd04109 Rab28 Rab28 subfamily.  87.4    0.37   8E-06   49.0   2.3   20  532-551     1-20  (215)
192 TIGR01360 aden_kin_iso1 adenyl  87.3    0.37   8E-06   47.1   2.2   21  532-552     4-24  (188)
193 cd00878 Arf_Arl Arf (ADP-ribos  87.3    0.38 8.2E-06   45.4   2.2   20  533-552     1-20  (158)
194 COG1122 CbiO ABC-type cobalt t  87.2    0.35 7.7E-06   51.3   2.2   27  531-557    30-56  (235)
195 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  87.2    0.41 8.9E-06   45.6   2.4   36  745-781    51-86  (166)
196 cd04108 Rab36_Rab34 Rab34/Rab3  87.2     0.4 8.6E-06   46.9   2.4   20  533-552     2-21  (170)
197 TIGR01351 adk adenylate kinase  87.1    0.37 8.1E-06   49.1   2.2   24  533-556     1-24  (210)
198 PRK00300 gmk guanylate kinase;  86.9     0.4 8.6E-06   48.1   2.2   24  532-555     6-29  (205)
199 PRK08233 hypothetical protein;  86.8    0.47   1E-05   46.2   2.6   21  532-552     4-24  (182)
200 KOG0084 GTPase Rab1/YPT1, smal  86.7    0.62 1.3E-05   48.8   3.5   38  743-781    56-93  (205)
201 cd01871 Rac1_like Rac1-like su  86.7    0.47   1E-05   46.7   2.5   21  532-552     2-22  (174)
202 PRK13695 putative NTPase; Prov  86.7    0.43 9.4E-06   47.0   2.3   20  532-551     1-20  (174)
203 PTZ00088 adenylate kinase 1; P  86.7    0.48   1E-05   50.0   2.8   28  529-556     4-31  (229)
204 PLN03071 GTP-binding nuclear p  86.6    0.45 9.8E-06   48.9   2.5   23  529-551    11-33  (219)
205 cd04111 Rab39 Rab39 subfamily.  86.5    0.46   1E-05   48.5   2.5   22  531-552     2-23  (211)
206 PF00004 AAA:  ATPase family as  86.5    0.46   1E-05   43.2   2.2   19  534-552     1-19  (132)
207 cd03280 ABC_MutS2 MutS2 homolo  86.5    0.47   1E-05   48.1   2.5   20  533-552    30-49  (200)
208 cd04115 Rab33B_Rab33A Rab33B/R  86.4    0.87 1.9E-05   44.0   4.2   36  745-781    51-87  (170)
209 cd03219 ABC_Mj1267_LivG_branch  86.3    0.45 9.8E-06   48.8   2.3   26  530-555    25-50  (236)
210 PF13173 AAA_14:  AAA domain     86.3    0.47   1E-05   44.6   2.2   19  534-552     5-23  (128)
211 TIGR01359 UMP_CMP_kin_fam UMP-  86.2    0.54 1.2E-05   46.2   2.7   23  534-556     2-24  (183)
212 PRK14530 adenylate kinase; Pro  86.2    0.56 1.2E-05   48.0   2.9   24  533-556     5-28  (215)
213 PRK00454 engB GTP-binding prot  86.2     0.5 1.1E-05   46.3   2.4   26  527-552    20-45  (196)
214 cd03292 ABC_FtsE_transporter F  86.1    0.48   1E-05   47.8   2.4   27  530-556    26-52  (214)
215 cd00227 CPT Chloramphenicol (C  86.1    0.62 1.3E-05   46.1   3.1   22  534-555     5-26  (175)
216 smart00174 RHO Rho (Ras homolo  86.1     1.4   3E-05   42.2   5.4   36  745-781    46-81  (174)
217 cd03255 ABC_MJ0796_Lo1CDE_FtsE  85.9     0.5 1.1E-05   47.9   2.4   26  530-555    29-54  (218)
218 TIGR00235 udk uridine kinase.   85.9    0.55 1.2E-05   47.8   2.7   24  531-554     6-29  (207)
219 cd03238 ABC_UvrA The excision   85.9     0.5 1.1E-05   47.8   2.4   22  530-551    20-41  (176)
220 cd00071 GMPK Guanosine monopho  85.9    0.57 1.2E-05   45.2   2.6   23  534-556     2-24  (137)
221 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  85.9    0.92   2E-05   47.9   4.4   38  745-783    61-98  (232)
222 cd03226 ABC_cobalt_CbiO_domain  85.8    0.51 1.1E-05   47.6   2.3   25  531-555    26-50  (205)
223 cd00877 Ran Ran (Ras-related n  85.7     1.2 2.7E-05   43.2   4.9   36  745-781    49-84  (166)
224 cd04121 Rab40 Rab40 subfamily.  85.7    0.48   1E-05   48.0   2.2   23  530-552     5-27  (189)
225 COG1126 GlnQ ABC-type polar am  85.7    0.48 1.1E-05   50.5   2.2   28  530-557    27-54  (240)
226 cd03262 ABC_HisP_GlnQ_permease  85.7    0.52 1.1E-05   47.5   2.4   26  530-555    25-50  (213)
227 smart00534 MUTSac ATPase domai  85.6    0.58 1.3E-05   47.0   2.7   21  534-554     2-22  (185)
228 cd04126 Rab20 Rab20 subfamily.  85.6     1.6 3.6E-05   45.5   6.0   36  745-781    44-79  (220)
229 cd04146 RERG_RasL11_like RERG/  85.6    0.51 1.1E-05   45.1   2.1   19  533-551     1-19  (165)
230 cd00009 AAA The AAA+ (ATPases   85.6    0.55 1.2E-05   42.1   2.2   25  530-554    18-42  (151)
231 cd02019 NK Nucleoside/nucleoti  85.5    0.61 1.3E-05   39.9   2.4   21  534-554     2-22  (69)
232 cd00820 PEPCK_HprK Phosphoenol  85.5    0.53 1.1E-05   44.7   2.2   21  531-551    15-35  (107)
233 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  85.5    0.55 1.2E-05   47.1   2.4   24  529-552     3-26  (182)
234 cd03234 ABCG_White The White s  85.4    0.55 1.2E-05   48.2   2.4   26  530-555    32-57  (226)
235 cd00154 Rab Rab family.  Rab G  85.4     0.5 1.1E-05   43.3   1.9   36  745-781    49-84  (159)
236 TIGR00960 3a0501s02 Type II (G  85.3    0.55 1.2E-05   47.6   2.4   26  531-556    29-54  (216)
237 TIGR02673 FtsE cell division A  85.3    0.55 1.2E-05   47.5   2.4   26  530-555    27-52  (214)
238 cd01120 RecA-like_NTPases RecA  85.3    0.55 1.2E-05   43.7   2.2   18  534-551     2-19  (165)
239 PRK02496 adk adenylate kinase;  85.3    0.71 1.5E-05   45.8   3.0   25  532-556     2-26  (184)
240 cd04177 RSR1 RSR1 subgroup.  R  85.3     1.2 2.5E-05   43.0   4.4   36  745-781    49-84  (168)
241 cd03281 ABC_MSH5_euk MutS5 hom  85.3    0.65 1.4E-05   48.1   2.9   23  532-554    30-52  (213)
242 PRK00279 adk adenylate kinase;  85.2    0.57 1.2E-05   48.0   2.4   25  532-556     1-25  (215)
243 cd03272 ABC_SMC3_euk Eukaryoti  85.2    0.62 1.4E-05   48.0   2.7   24  533-556    25-48  (243)
244 cd04128 Spg1 Spg1p.  Spg1p (se  85.1    0.57 1.2E-05   46.7   2.3   21  532-552     1-21  (182)
245 PF13304 AAA_21:  AAA domain; P  85.0    0.28   6E-06   47.3   0.0   21  535-555     3-23  (303)
246 cd03264 ABC_drug_resistance_li  85.0    0.56 1.2E-05   47.4   2.2   24  533-556    27-50  (211)
247 cd03259 ABC_Carb_Solutes_like   84.9     0.6 1.3E-05   47.3   2.4   24  531-554    26-49  (213)
248 cd03269 ABC_putative_ATPase Th  84.8     0.6 1.3E-05   47.1   2.4   25  531-555    26-50  (210)
249 cd03301 ABC_MalK_N The N-termi  84.8    0.58 1.2E-05   47.3   2.2   25  531-555    26-50  (213)
250 cd03218 ABC_YhbG The ABC trans  84.8     0.6 1.3E-05   47.8   2.4   25  531-555    26-50  (232)
251 PLN03118 Rab family protein; P  84.8    0.64 1.4E-05   47.0   2.5   22  530-551    13-34  (211)
252 COG4598 HisP ABC-type histidin  84.8     1.8 3.8E-05   45.6   5.6   24  534-557    35-58  (256)
253 cd03214 ABC_Iron-Siderophores_  84.7    0.62 1.4E-05   46.3   2.4   27  530-556    24-50  (180)
254 cd03266 ABC_NatA_sodium_export  84.7    0.62 1.3E-05   47.3   2.4   25  531-555    31-55  (218)
255 cd04144 Ras2 Ras2 subfamily.    84.6    0.62 1.3E-05   46.2   2.3   20  533-552     1-20  (190)
256 cd02023 UMPK Uridine monophosp  84.6     0.7 1.5E-05   46.4   2.7   22  534-555     2-23  (198)
257 cd03247 ABCC_cytochrome_bd The  84.5    0.64 1.4E-05   46.0   2.4   26  531-556    28-53  (178)
258 cd03265 ABC_DrrA DrrA is the A  84.5    0.64 1.4E-05   47.4   2.4   25  531-555    26-50  (220)
259 TIGR02211 LolD_lipo_ex lipopro  84.5    0.64 1.4E-05   47.2   2.4   24  531-554    31-54  (221)
260 cd04123 Rab21 Rab21 subfamily.  84.4    0.67 1.5E-05   43.2   2.3   38  745-783    49-86  (162)
261 TIGR03410 urea_trans_UrtE urea  84.4    0.64 1.4E-05   47.6   2.3   27  529-555    24-50  (230)
262 cd04137 RheB Rheb (Ras Homolog  84.4    0.99 2.1E-05   43.7   3.5   38  745-783    49-86  (180)
263 TIGR01978 sufC FeS assembly AT  84.4    0.65 1.4E-05   47.8   2.4   25  530-554    25-49  (243)
264 PRK14531 adenylate kinase; Pro  84.3     0.8 1.7E-05   45.8   2.9   25  532-556     3-27  (183)
265 cd04135 Tc10 TC10 subfamily.    84.3       2 4.3E-05   41.2   5.6   36  745-781    48-83  (174)
266 cd01866 Rab2 Rab2 subfamily.    84.3     1.1 2.4E-05   43.3   3.8   36  745-781    53-88  (168)
267 cd01862 Rab7 Rab7 subfamily.    84.3    0.69 1.5E-05   43.9   2.4   36  745-781    49-84  (172)
268 cd03258 ABC_MetN_methionine_tr  84.2    0.63 1.4E-05   47.8   2.2   27  530-556    30-56  (233)
269 cd03235 ABC_Metallic_Cations A  84.2    0.66 1.4E-05   47.0   2.3   26  530-555    24-49  (213)
270 TIGR02315 ABC_phnC phosphonate  84.2    0.65 1.4E-05   47.9   2.3   26  530-555    27-52  (243)
271 cd01867 Rab8_Rab10_Rab13_like   84.2    0.67 1.5E-05   44.6   2.3   36  745-781    52-87  (167)
272 cd03224 ABC_TM1139_LivF_branch  84.2    0.66 1.4E-05   47.1   2.3   26  530-555    25-50  (222)
273 cd01897 NOG NOG1 is a nucleola  84.2    0.69 1.5E-05   44.0   2.3   20  533-552     2-21  (168)
274 cd04104 p47_IIGP_like p47 (47-  84.2     0.7 1.5E-05   46.7   2.5   21  532-552     2-22  (197)
275 TIGR03608 L_ocin_972_ABC putat  84.2    0.68 1.5E-05   46.5   2.4   26  531-556    24-49  (206)
276 PRK05480 uridine/cytidine kina  84.1    0.72 1.6E-05   46.7   2.6   25  530-554     5-29  (209)
277 PRK15177 Vi polysaccharide exp  84.1    0.64 1.4E-05   47.7   2.2   24  532-555    14-37  (213)
278 PF04670 Gtr1_RagA:  Gtr1/RagA   84.1     2.1 4.6E-05   45.6   6.1   36  745-780    48-87  (232)
279 cd03261 ABC_Org_Solvent_Resist  84.1    0.67 1.5E-05   47.7   2.4   26  531-556    26-51  (235)
280 cd04118 Rab24 Rab24 subfamily.  84.0    0.93   2E-05   44.6   3.2   37  745-782    50-86  (193)
281 PRK11701 phnK phosphonate C-P   84.0    0.68 1.5E-05   48.5   2.4   28  529-556    30-57  (258)
282 PRK13543 cytochrome c biogenes  83.9     0.7 1.5E-05   47.2   2.4   26  531-556    37-62  (214)
283 PLN03110 Rab GTPase; Provision  83.9    0.74 1.6E-05   47.1   2.6   22  530-551    11-32  (216)
284 cd03279 ABC_sbcCD SbcCD and ot  83.8    0.51 1.1E-05   48.3   1.3   24  533-556    30-54  (213)
285 cd04109 Rab28 Rab28 subfamily.  83.8    0.71 1.5E-05   47.0   2.3   37  745-782    50-86  (215)
286 cd03225 ABC_cobalt_CbiO_domain  83.8    0.72 1.6E-05   46.5   2.4   25  531-555    27-51  (211)
287 cd04111 Rab39 Rab39 subfamily.  83.7     1.2 2.5E-05   45.6   3.9   36  745-781    52-87  (211)
288 cd04143 Rhes_like Rhes_like su  83.7    0.69 1.5E-05   49.0   2.3   21  532-552     1-21  (247)
289 TIGR01166 cbiO cobalt transpor  83.7     0.7 1.5E-05   46.1   2.2   25  532-556    19-43  (190)
290 cd03256 ABC_PhnC_transporter A  83.7    0.68 1.5E-05   47.6   2.2   26  531-556    27-52  (241)
291 PRK11629 lolD lipoprotein tran  83.6    0.72 1.6E-05   47.5   2.4   24  531-554    35-58  (233)
292 PRK13540 cytochrome c biogenes  83.6    0.73 1.6E-05   46.5   2.4   27  530-556    26-52  (200)
293 cd03263 ABC_subfamily_A The AB  83.6    0.69 1.5E-05   47.0   2.2   26  531-556    28-53  (220)
294 cd04131 Rnd Rnd subfamily.  Th  83.6    0.77 1.7E-05   45.7   2.5   21  532-552     2-22  (178)
295 cd04113 Rab4 Rab4 subfamily.    83.6    0.75 1.6E-05   43.5   2.3   37  745-782    49-85  (161)
296 cd04162 Arl9_Arfrp2_like Arl9/  83.6    0.74 1.6E-05   44.7   2.3   19  534-552     2-20  (164)
297 cd01898 Obg Obg subfamily.  Th  83.6    0.73 1.6E-05   43.8   2.2   20  533-552     2-21  (170)
298 cd04146 RERG_RasL11_like RERG/  83.6     1.5 3.2E-05   41.9   4.3   38  745-782    47-84  (165)
299 cd01861 Rab6 Rab6 subfamily.    83.6     1.3 2.8E-05   41.7   3.8   36  745-781    49-84  (161)
300 cd03293 ABC_NrtD_SsuB_transpor  83.5     0.7 1.5E-05   47.1   2.2   25  531-555    30-54  (220)
301 PRK04213 GTP-binding protein;   83.5    0.73 1.6E-05   45.8   2.3   23  530-552     8-30  (201)
302 PF13191 AAA_16:  AAA ATPase do  83.5    0.74 1.6E-05   44.5   2.3   22  531-552    24-45  (185)
303 PRK11264 putative amino-acid A  83.5    0.73 1.6E-05   47.8   2.4   26  530-555    28-53  (250)
304 PRK14242 phosphate transporter  83.5    0.73 1.6E-05   48.0   2.4   23  530-552    31-53  (253)
305 cd03232 ABC_PDR_domain2 The pl  83.5    0.76 1.6E-05   46.2   2.4   23  530-552    32-54  (192)
306 cd03257 ABC_NikE_OppD_transpor  83.4    0.74 1.6E-05   46.8   2.3   27  530-556    30-56  (228)
307 cd03229 ABC_Class3 This class   83.4    0.73 1.6E-05   45.7   2.2   27  530-556    25-51  (178)
308 cd03252 ABCC_Hemolysin The ABC  83.4    0.75 1.6E-05   47.4   2.4   25  530-554    27-51  (237)
309 COG4615 PvdE ABC-type sideroph  83.3    0.93   2E-05   52.2   3.2   42  532-573   350-400 (546)
310 cd03222 ABC_RNaseL_inhibitor T  83.3    0.71 1.5E-05   46.8   2.1   27  530-556    24-50  (177)
311 COG1120 FepC ABC-type cobalami  83.3     0.7 1.5E-05   50.0   2.2   24  534-557    31-54  (258)
312 cd04103 Centaurin_gamma Centau  83.2     1.9 4.1E-05   42.0   5.0   55  745-817    47-101 (158)
313 PRK10771 thiQ thiamine transpo  83.1    0.77 1.7E-05   47.3   2.3   26  531-556    25-50  (232)
314 PLN00023 GTP-binding protein;   83.1    0.93   2E-05   50.8   3.1   36  745-781    83-118 (334)
315 TIGR01189 ccmA heme ABC export  83.1     0.8 1.7E-05   46.0   2.4   27  530-556    25-51  (198)
316 cd03260 ABC_PstB_phosphate_tra  83.1    0.79 1.7E-05   46.9   2.4   26  530-555    25-50  (227)
317 PLN03118 Rab family protein; P  83.0    0.84 1.8E-05   46.1   2.5   36  745-781    62-97  (211)
318 cd04148 RGK RGK subfamily.  Th  83.0    0.77 1.7E-05   47.4   2.3   21  532-552     1-21  (221)
319 cd04102 RabL3 RabL3 (Rab-like3  83.0    0.79 1.7E-05   47.2   2.3   21  532-552     1-21  (202)
320 cd03297 ABC_ModC_molybdenum_tr  83.0    0.76 1.7E-05   46.6   2.2   24  532-555    24-47  (214)
321 PF13479 AAA_24:  AAA domain     82.9     0.7 1.5E-05   47.6   2.0   23  529-551     1-23  (213)
322 cd03249 ABC_MTABC3_MDL1_MDL2 M  82.9    0.79 1.7E-05   47.2   2.3   26  530-555    28-53  (238)
323 PRK11176 lipid transporter ATP  82.9     1.2 2.5E-05   52.1   3.9   31  527-557   365-395 (582)
324 PRK05057 aroK shikimate kinase  82.9    0.82 1.8E-05   45.6   2.3   22  532-553     5-26  (172)
325 cd03230 ABC_DR_subfamily_A Thi  82.9    0.83 1.8E-05   45.1   2.4   25  531-555    26-50  (173)
326 cd00464 SK Shikimate kinase (S  82.8    0.88 1.9E-05   43.1   2.4   23  534-556     2-24  (154)
327 PRK00131 aroK shikimate kinase  82.8    0.83 1.8E-05   43.8   2.3   26  531-556     4-29  (175)
328 TIGR02770 nickel_nikD nickel i  82.8    0.77 1.7E-05   47.3   2.2   26  531-556    12-37  (230)
329 cd03254 ABCC_Glucan_exporter_l  82.8    0.82 1.8E-05   46.7   2.4   25  531-555    29-53  (229)
330 PRK10463 hydrogenase nickel in  82.7    0.67 1.5E-05   50.9   1.8   29  524-552    97-125 (290)
331 PHA02530 pseT polynucleotide k  82.7    0.77 1.7E-05   48.8   2.2   22  534-555     5-26  (300)
332 cd04147 Ras_dva Ras-dva subfam  82.7    0.78 1.7E-05   45.9   2.1   19  533-551     1-19  (198)
333 cd04132 Rho4_like Rho4-like su  82.7       1 2.2E-05   44.0   2.9   36  745-781    49-84  (187)
334 cd03215 ABC_Carb_Monos_II This  82.7    0.84 1.8E-05   45.4   2.3   26  531-556    26-51  (182)
335 cd04171 SelB SelB subfamily.    82.7     1.2 2.6E-05   41.7   3.2   36  745-781    51-86  (164)
336 cd03223 ABCD_peroxisomal_ALDP   82.7    0.86 1.9E-05   45.0   2.4   26  530-555    26-51  (166)
337 smart00174 RHO Rho (Ras homolo  82.6     0.7 1.5E-05   44.3   1.7   18  534-551     1-18  (174)
338 TIGR03015 pepcterm_ATPase puta  82.6    0.79 1.7E-05   47.6   2.2   25  531-555    43-67  (269)
339 PRK10584 putative ABC transpor  82.6     0.8 1.7E-05   46.9   2.2   26  531-556    36-61  (228)
340 cd03267 ABC_NatA_like Similar   82.6    0.83 1.8E-05   47.4   2.4   26  530-555    46-71  (236)
341 cd03253 ABCC_ATM1_transporter   82.6    0.84 1.8E-05   46.9   2.3   27  530-556    26-52  (236)
342 PRK09825 idnK D-gluconate kina  82.6    0.81 1.8E-05   46.0   2.2   24  533-556     5-28  (176)
343 COG0529 CysC Adenylylsulfate k  82.6       2 4.3E-05   44.8   5.0   27  525-551    17-43  (197)
344 PRK10895 lipopolysaccharide AB  82.6    0.84 1.8E-05   47.2   2.4   27  530-556    28-54  (241)
345 cd04126 Rab20 Rab20 subfamily.  82.6    0.82 1.8E-05   47.7   2.3   20  532-551     1-20  (220)
346 PRK14241 phosphate transporter  82.6    0.79 1.7E-05   48.0   2.2   26  530-555    29-54  (258)
347 PRK10908 cell division protein  82.5    0.85 1.8E-05   46.6   2.4   27  530-556    27-53  (222)
348 cd03216 ABC_Carb_Monos_I This   82.5    0.88 1.9E-05   44.8   2.4   25  530-554    25-49  (163)
349 cd03295 ABC_OpuCA_Osmoprotecti  82.5    0.85 1.8E-05   47.3   2.4   26  531-556    27-52  (242)
350 cd02025 PanK Pantothenate kina  82.4    0.91   2E-05   47.3   2.6   22  534-555     2-23  (220)
351 PRK06762 hypothetical protein;  82.4     0.9 1.9E-05   44.1   2.4   24  533-556     4-27  (166)
352 PRK11248 tauB taurine transpor  82.4    0.85 1.8E-05   48.1   2.4   26  530-555    26-51  (255)
353 cd03296 ABC_CysA_sulfate_impor  82.3    0.87 1.9E-05   47.1   2.3   26  531-556    28-53  (239)
354 PRK15056 manganese/iron transp  82.2    0.86 1.9E-05   48.4   2.3   26  531-556    33-58  (272)
355 cd03251 ABCC_MsbA MsbA is an e  82.2    0.89 1.9E-05   46.6   2.4   26  530-555    27-52  (234)
356 PRK14527 adenylate kinase; Pro  82.1    0.87 1.9E-05   45.7   2.2   25  532-556     7-31  (191)
357 PRK13539 cytochrome c biogenes  82.1     0.9   2E-05   46.1   2.4   26  530-555    27-52  (207)
358 PF02421 FeoB_N:  Ferrous iron   82.1    0.99 2.1E-05   45.3   2.6   21  532-552     1-21  (156)
359 PRK14526 adenylate kinase; Pro  82.0     0.9 1.9E-05   47.3   2.3   24  533-556     2-25  (211)
360 PRK04182 cytidylate kinase; Pr  82.0    0.93   2E-05   43.9   2.3   20  533-552     2-21  (180)
361 PF07728 AAA_5:  AAA domain (dy  82.0       1 2.2E-05   42.4   2.5   23  534-556     2-24  (139)
362 KOG0090 Signal recognition par  82.0     2.4 5.1E-05   45.3   5.3   59  746-815    83-144 (238)
363 cd01870 RhoA_like RhoA-like su  81.9     2.8   6E-05   40.3   5.5   36  745-781    49-84  (175)
364 cd00882 Ras_like_GTPase Ras-li  81.9    0.64 1.4E-05   41.2   1.1   16  536-551     1-16  (157)
365 COG3842 PotA ABC-type spermidi  81.9    0.84 1.8E-05   51.4   2.2   23  534-556    34-56  (352)
366 PRK11124 artP arginine transpo  81.9    0.91   2E-05   46.9   2.4   26  530-555    27-52  (242)
367 COG3638 ABC-type phosphate/pho  81.9     1.3 2.7E-05   48.0   3.4   26  532-557    31-56  (258)
368 cd04119 RJL RJL (RabJ-Like) su  81.9    0.92   2E-05   42.5   2.2   37  745-782    49-85  (168)
369 TIGR01277 thiQ thiamine ABC tr  81.9    0.89 1.9E-05   46.2   2.2   26  530-555    23-48  (213)
370 PRK13638 cbiO cobalt transport  81.9    0.91   2E-05   48.1   2.3   25  531-555    27-51  (271)
371 PRK11614 livF leucine/isoleuci  81.8    0.93   2E-05   46.7   2.3   26  531-556    31-56  (237)
372 PRK14738 gmk guanylate kinase;  81.8    0.97 2.1E-05   46.3   2.4   23  530-552    12-34  (206)
373 cd03268 ABC_BcrA_bacitracin_re  81.8    0.91   2E-05   45.8   2.2   24  531-554    26-49  (208)
374 PRK14528 adenylate kinase; Pro  81.7     1.2 2.5E-05   45.1   2.9   25  532-556     2-26  (186)
375 cd03246 ABCC_Protease_Secretio  81.7    0.93   2E-05   44.7   2.2   26  531-556    28-53  (173)
376 cd03298 ABC_ThiQ_thiamine_tran  81.5    0.97 2.1E-05   45.7   2.3   26  531-556    24-49  (211)
377 PRK11247 ssuB aliphatic sulfon  81.5    0.95 2.1E-05   48.1   2.4   25  531-555    38-62  (257)
378 TIGR02323 CP_lyasePhnK phospho  81.5    0.96 2.1E-05   47.1   2.4   26  530-555    28-53  (253)
379 cd00267 ABC_ATPase ABC (ATP-bi  81.5       1 2.2E-05   43.5   2.4   26  531-556    25-50  (157)
380 cd04105 SR_beta Signal recogni  81.5       1 2.2E-05   46.0   2.4   20  533-552     2-21  (203)
381 TIGR02769 nickel_nikE nickel i  81.5    0.96 2.1E-05   47.7   2.4   27  530-556    36-62  (265)
382 cd01868 Rab11_like Rab11-like.  81.4     1.4   3E-05   41.9   3.2   36  745-781    52-87  (165)
383 COG1121 ZnuC ABC-type Mn/Zn tr  81.4    0.92   2E-05   49.0   2.2   21  532-552    31-51  (254)
384 cd00880 Era_like Era (E. coli   81.4     0.7 1.5E-05   41.7   1.1   16  536-551     1-16  (163)
385 TIGR03005 ectoine_ehuA ectoine  81.4    0.97 2.1E-05   47.1   2.3   27  530-556    25-51  (252)
386 PRK11300 livG leucine/isoleuci  81.4    0.97 2.1E-05   47.1   2.3   26  530-555    30-55  (255)
387 cd03237 ABC_RNaseL_inhibitor_d  81.4    0.97 2.1E-05   47.7   2.4   25  531-555    25-49  (246)
388 cd03245 ABCC_bacteriocin_expor  81.4       1 2.2E-05   45.8   2.4   26  530-555    29-54  (220)
389 PRK09493 glnQ glutamine ABC tr  81.3       1 2.2E-05   46.6   2.4   26  531-556    27-52  (240)
390 PF10662 PduV-EutP:  Ethanolami  81.3    0.97 2.1E-05   45.0   2.1   20  533-552     3-22  (143)
391 PRK14250 phosphate ABC transpo  81.2       1 2.2E-05   46.9   2.4   24  531-554    29-52  (241)
392 COG4559 ABC-type hemin transpo  81.2    0.93   2E-05   48.5   2.1   42  534-575    30-83  (259)
393 TIGR01184 ntrCD nitrate transp  81.1       1 2.2E-05   46.6   2.4   24  531-554    11-34  (230)
394 PRK14245 phosphate ABC transpo  81.1    0.96 2.1E-05   47.1   2.2   22  531-552    29-50  (250)
395 TIGR03411 urea_trans_UrtD urea  81.1       1 2.2E-05   46.5   2.3   26  530-555    27-52  (242)
396 PRK00625 shikimate kinase; Pro  81.1       1 2.3E-05   45.5   2.3   21  533-553     2-22  (173)
397 COG3839 MalK ABC-type sugar tr  81.0    0.95 2.1E-05   50.8   2.2   24  534-557    32-55  (338)
398 TIGR01288 nodI ATP-binding ABC  81.0       1 2.2E-05   48.7   2.4   26  530-555    29-54  (303)
399 TIGR01526 nadR_NMN_Atrans nico  81.0     1.1 2.4E-05   49.5   2.7   29  531-560   162-190 (325)
400 TIGR03574 selen_PSTK L-seryl-t  81.0       1 2.2E-05   47.1   2.4   20  534-553     2-21  (249)
401 cd04112 Rab26 Rab26 subfamily.  81.0     1.1 2.4E-05   44.5   2.5   37  745-782    50-86  (191)
402 cd03228 ABCC_MRP_Like The MRP   81.0       1 2.2E-05   44.4   2.2   27  530-556    27-53  (171)
403 PRK11831 putative ABC transpor  80.9       1 2.2E-05   47.7   2.3   25  531-555    33-57  (269)
404 PRK13541 cytochrome c biogenes  80.9     1.1 2.3E-05   45.1   2.4   26  531-556    26-51  (195)
405 cd01890 LepA LepA subfamily.    80.9    0.95 2.1E-05   43.6   1.9   37  745-782    67-103 (179)
406 TIGR01193 bacteriocin_ABC ABC-  80.9     1.4 3.1E-05   52.8   3.8   30  528-557   497-526 (708)
407 cd04125 RabA_like RabA-like su  80.8     1.1 2.5E-05   44.0   2.5   36  745-781    49-84  (188)
408 PRK10790 putative multidrug tr  80.8     1.4 3.1E-05   51.6   3.7   32  526-557   362-393 (592)
409 TIGR00972 3a0107s01c2 phosphat  80.8       1 2.2E-05   46.9   2.2   25  531-555    27-51  (247)
410 PRK14273 phosphate ABC transpo  80.8     1.1 2.3E-05   46.9   2.4   27  530-556    32-58  (254)
411 PLN00023 GTP-binding protein;   80.8     1.1 2.4E-05   50.2   2.6   24  529-552    19-42  (334)
412 PRK14267 phosphate ABC transpo  80.8       1 2.2E-05   47.0   2.2   26  530-555    29-54  (253)
413 PRK14737 gmk guanylate kinase;  80.7       1 2.2E-05   45.8   2.2   19  534-552     7-25  (186)
414 PRK10247 putative ABC transpor  80.7     1.1 2.3E-05   46.2   2.4   25  530-554    32-56  (225)
415 cd03236 ABC_RNaseL_inhibitor_d  80.7     1.1 2.3E-05   47.8   2.4   27  531-557    26-52  (255)
416 TIGR02324 CP_lyasePhnL phospho  80.7       1 2.2E-05   45.9   2.2   27  530-556    33-59  (224)
417 PF04670 Gtr1_RagA:  Gtr1/RagA   80.7     1.1 2.5E-05   47.5   2.6   35  533-572     1-35  (232)
418 PF00735 Septin:  Septin;  Inte  80.6     1.2 2.7E-05   48.3   2.9   21  531-551     4-24  (281)
419 PRK13538 cytochrome c biogenes  80.6     1.1 2.4E-05   45.3   2.4   24  531-554    27-50  (204)
420 TIGR03771 anch_rpt_ABC anchore  80.6     1.1 2.3E-05   46.2   2.3   25  532-556     7-31  (223)
421 cd03227 ABC_Class2 ABC-type Cl  80.5     1.3 2.8E-05   43.6   2.7   25  532-556    22-46  (162)
422 COG1127 Ttg2A ABC-type transpo  80.5     1.5 3.2E-05   47.6   3.3   24  534-557    37-60  (263)
423 TIGR03864 PQQ_ABC_ATP ABC tran  80.5     1.1 2.4E-05   46.3   2.4   27  530-556    26-52  (236)
424 PRK10418 nikD nickel transport  80.5     1.1 2.4E-05   47.0   2.3   26  530-555    28-53  (254)
425 cd04133 Rop_like Rop subfamily  80.5     1.2 2.6E-05   44.5   2.6   26  532-561     2-27  (176)
426 cd04116 Rab9 Rab9 subfamily.    80.4     1.2 2.6E-05   42.7   2.4   36  745-781    54-89  (170)
427 PRK14247 phosphate ABC transpo  80.4     1.1 2.4E-05   46.6   2.3   26  530-555    28-53  (250)
428 PRK14240 phosphate transporter  80.4     1.1 2.3E-05   46.7   2.2   22  531-552    29-50  (250)
429 cd03213 ABCG_EPDR ABCG transpo  80.4     1.1 2.5E-05   45.1   2.4   26  530-555    34-59  (194)
430 cd03217 ABC_FeS_Assembly ABC-t  80.4     1.1 2.3E-05   45.4   2.2   25  530-554    25-49  (200)
431 PRK14248 phosphate ABC transpo  80.4     1.1 2.3E-05   47.5   2.2   22  531-552    47-68  (268)
432 cd01131 PilT Pilus retraction   80.4     1.1 2.3E-05   45.7   2.2   18  534-551     4-21  (198)
433 PRK14251 phosphate ABC transpo  80.3     1.1 2.4E-05   46.6   2.4   24  531-554    30-53  (251)
434 PRK10744 pstB phosphate transp  80.3       1 2.3E-05   47.3   2.2   27  529-555    37-63  (260)
435 PRK13651 cobalt transporter AT  80.3     1.1 2.4E-05   48.9   2.3   27  530-556    32-58  (305)
436 cd03240 ABC_Rad50 The catalyti  80.3     1.3 2.7E-05   45.5   2.7   22  533-554    24-45  (204)
437 cd01130 VirB11-like_ATPase Typ  80.3     1.4   3E-05   44.3   2.9   23  530-552    24-46  (186)
438 PRK14239 phosphate transporter  80.2     1.1 2.4E-05   46.5   2.3   22  531-552    31-52  (252)
439 COG2274 SunT ABC-type bacterio  80.2       1 2.2E-05   54.9   2.3   31  527-557   495-525 (709)
440 PRK14256 phosphate ABC transpo  80.2     1.1 2.3E-05   46.8   2.2   25  531-555    30-54  (252)
441 PRK13650 cbiO cobalt transport  80.2     1.1 2.4E-05   47.8   2.4   26  531-556    33-58  (279)
442 cd03220 ABC_KpsT_Wzt ABC_KpsT_  80.2     1.1 2.5E-05   46.1   2.3   26  530-555    47-72  (224)
443 PRK10575 iron-hydroxamate tran  80.2     1.1 2.4E-05   47.3   2.3   27  529-555    35-61  (265)
444 cd03248 ABCC_TAP TAP, the Tran  80.2     1.2 2.5E-05   45.6   2.4   26  530-555    39-64  (226)
445 PRK01184 hypothetical protein;  80.2     1.2 2.7E-05   44.0   2.5   20  533-552     3-22  (184)
446 KOG2355 Predicted ABC-type tra  80.1     1.1 2.4E-05   47.8   2.3   22  530-551    39-60  (291)
447 cd03221 ABCF_EF-3 ABCF_EF-3  E  80.1     1.1 2.5E-05   43.2   2.2   25  531-555    26-50  (144)
448 PF06414 Zeta_toxin:  Zeta toxi  80.1     1.2 2.7E-05   45.1   2.5   28  528-555    12-39  (199)
449 cd04106 Rab23_lke Rab23-like s  80.1     1.2 2.5E-05   42.0   2.2   38  745-783    51-88  (162)
450 PRK09580 sufC cysteine desulfu  80.1     1.1 2.5E-05   46.2   2.3   25  530-554    26-50  (248)
451 cd01896 DRG The developmentall  80.1     1.2 2.5E-05   46.8   2.4   20  533-552     2-21  (233)
452 TIGR03740 galliderm_ABC gallid  80.0     1.2 2.6E-05   45.6   2.4   26  530-555    25-50  (223)
453 TIGR03375 type_I_sec_LssB type  80.0     1.7 3.7E-05   52.1   4.1   29  529-557   489-517 (694)
454 PRK08356 hypothetical protein;  79.9     1.2 2.6E-05   45.0   2.4   20  533-552     7-26  (195)
455 PRK14274 phosphate ABC transpo  79.9     1.2 2.5E-05   46.8   2.3   24  531-554    38-61  (259)
456 PRK14260 phosphate ABC transpo  79.9     1.2 2.5E-05   46.9   2.4   26  531-556    33-58  (259)
457 cd04142 RRP22 RRP22 subfamily.  79.9     1.2 2.5E-05   45.3   2.3   20  532-551     1-20  (198)
458 PRK13657 cyclic beta-1,2-gluca  79.9     1.6 3.4E-05   51.3   3.7   31  527-557   357-387 (588)
459 cd03244 ABCC_MRP_domain2 Domai  79.8     1.1 2.5E-05   45.4   2.2   26  531-556    30-55  (221)
460 PF04548 AIG1:  AIG1 family;  I  79.8     1.3 2.8E-05   45.6   2.6   20  532-551     1-20  (212)
461 PRK14529 adenylate kinase; Pro  79.8     1.4 3.1E-05   46.5   2.9   25  532-556     1-25  (223)
462 cd02027 APSK Adenosine 5'-phos  79.8     1.2 2.6E-05   43.4   2.2   22  534-555     2-23  (149)
463 PRK14265 phosphate ABC transpo  79.8     1.2 2.5E-05   47.6   2.3   25  530-554    45-69  (274)
464 cd03233 ABC_PDR_domain1 The pl  79.8     1.2 2.6E-05   45.3   2.3   26  531-556    33-58  (202)
465 PRK13645 cbiO cobalt transport  79.8     1.2 2.5E-05   47.8   2.4   25  531-555    37-61  (289)
466 cd03290 ABCC_SUR1_N The SUR do  79.8     1.2 2.5E-05   45.5   2.2   25  530-554    26-50  (218)
467 COG4175 ProV ABC-type proline/  79.7     1.9 4.1E-05   48.5   3.9   36  534-569    57-104 (386)
468 cd03231 ABC_CcmA_heme_exporter  79.7     1.2 2.7E-05   44.9   2.4   26  530-555    25-50  (201)
469 TIGR01188 drrA daunorubicin re  79.7     1.1 2.4E-05   48.3   2.2   25  531-555    19-43  (302)
470 PF13401 AAA_22:  AAA domain; P  79.7     1.3 2.8E-05   40.6   2.3   23  533-555     6-28  (131)
471 PRK13646 cbiO cobalt transport  79.6     1.2 2.6E-05   47.8   2.4   27  530-556    32-58  (286)
472 PRK09544 znuC high-affinity zi  79.6     1.2 2.6E-05   47.0   2.4   25  530-554    29-53  (251)
473 PRK13649 cbiO cobalt transport  79.6     1.2 2.6E-05   47.3   2.3   25  531-555    33-57  (280)
474 cd04102 RabL3 RabL3 (Rab-like3  79.6     1.3 2.9E-05   45.6   2.6   37  745-782    54-90  (202)
475 COG1117 PstB ABC-type phosphat  79.6     1.1 2.4E-05   48.0   2.0   22  535-556    37-58  (253)
476 KOG1673 Ras GTPases [General f  79.6     1.6 3.6E-05   44.6   3.1   36  744-781    68-104 (205)
477 PRK14238 phosphate transporter  79.6     1.2 2.6E-05   47.3   2.4   25  530-554    49-73  (271)
478 PRK13634 cbiO cobalt transport  79.6     1.1 2.4E-05   48.2   2.1   27  530-556    32-58  (290)
479 cd04140 ARHI_like ARHI subfami  79.6     2.4 5.3E-05   40.6   4.3   36  745-781    49-84  (165)
480 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  79.6     1.3 2.8E-05   46.8   2.6   22  530-551    12-33  (232)
481 cd03369 ABCC_NFT1 Domain 2 of   79.6     1.3 2.7E-05   44.9   2.4   27  530-556    33-59  (207)
482 PRK11231 fecE iron-dicitrate t  79.5     1.2 2.7E-05   46.5   2.4   26  530-555    27-52  (255)
483 PRK14262 phosphate ABC transpo  79.4     1.2 2.7E-05   46.2   2.4   25  530-554    28-52  (250)
484 COG4987 CydC ABC-type transpor  79.4     1.9 4.1E-05   51.1   4.0   30  527-556   360-389 (573)
485 TIGR00101 ureG urease accessor  79.4     1.3 2.9E-05   45.5   2.5   21  532-552     2-22  (199)
486 cd04120 Rab12 Rab12 subfamily.  79.4     1.3 2.8E-05   45.5   2.4   21  532-552     1-21  (202)
487 cd01858 NGP_1 NGP-1.  Autoanti  79.4     1.5 3.3E-05   42.4   2.8   23  530-552   101-123 (157)
488 PRK14268 phosphate ABC transpo  79.3     1.2 2.6E-05   46.8   2.2   25  531-555    38-62  (258)
489 CHL00131 ycf16 sulfate ABC tra  79.2     1.3 2.7E-05   46.1   2.3   24  529-552    31-54  (252)
490 PF00485 PRK:  Phosphoribulokin  79.1       2 4.3E-05   43.3   3.6   27  534-560     2-28  (194)
491 PRK13637 cbiO cobalt transport  79.1     1.3 2.7E-05   47.7   2.3   25  531-555    33-57  (287)
492 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  79.1     1.4 2.9E-05   46.2   2.5   21  532-552     2-22  (222)
493 PRK14269 phosphate ABC transpo  79.0     1.3 2.8E-05   46.1   2.4   24  531-554    28-51  (246)
494 PRK14261 phosphate ABC transpo  79.0     1.3 2.8E-05   46.3   2.3   22  531-552    32-53  (253)
495 PRK06547 hypothetical protein;  79.0     1.6 3.4E-05   44.1   2.9   27  526-552    10-36  (172)
496 PRK14255 phosphate ABC transpo  79.0     1.2 2.7E-05   46.3   2.2   23  531-553    31-53  (252)
497 PF00071 Ras:  Ras family;  Int  79.0     2.4 5.3E-05   40.0   4.0   36  745-781    48-83  (162)
498 PF09439 SRPRB:  Signal recogni  79.0     1.4   3E-05   45.4   2.4   21  532-552     4-24  (181)
499 PRK14235 phosphate transporter  78.9     1.3 2.8E-05   46.9   2.4   25  531-555    45-69  (267)
500 cd03294 ABC_Pro_Gly_Bertaine T  78.9     1.2 2.7E-05   47.2   2.2   26  531-556    50-75  (269)

No 1  
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms]
Probab=100.00  E-value=5e-71  Score=595.09  Aligned_cols=250  Identities=34%  Similarity=0.518  Sum_probs=220.1

Q ss_pred             cccccccCch-hHHHhcceeeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHHHHHHHHHHHHHHhhhccchh
Q 003444          514 GSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEE  592 (819)
Q Consensus       514 ~S~~IDr~L~-dk~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iIqsNIi~sm~iLLea~e~fe~  592 (819)
                      .|..||++|+ ++++.++.+||||||+||||||||+|||||||. +|||++|+..+|.+||.|++++|..||+||+.+++
T Consensus        15 ~~~~I~~~l~~~~~~~~~~iKlLLLGageSGKSTI~KQmkilh~-~gfs~ee~~~~r~~I~~N~~~~~~~ll~a~~~~~i   93 (354)
T KOG0082|consen   15 RSKEIDKQLKKEKKKEKKIIKLLLLGAGESGKSTIVKQMKILHG-DGFSEEELLEYRPVIYSNIIQSLKALLRAMETLGI   93 (354)
T ss_pred             hhhhhhHHHHHHHHhhhhheeeeeecCCCCchHHHHHHHHHHhc-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            7899999998 889999999999999999999999999999999 99999999999999999999999999999986665


Q ss_pred             hHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhh-hhcCCccccCcccchhHHHHHHHHhcCHHHHHH
Q 003444          593 EILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKT-MVSGNLEAIFPAATREYSPLVEELWKDAAIQAT  671 (819)
Q Consensus       593 e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~-~~~g~ld~~fp~~t~E~A~aI~eLWkDpgIQ~~  671 (819)
                      +.                +.+...++.         ..    ++.. ...++.    +.+++|++++|++||+||+||+|
T Consensus        94 ~~----------------~~~~~~~d~---------~~----~~~~~~~~~~~----~~~~~e~~~~i~~lW~d~~Iq~~  140 (354)
T KOG0082|consen   94 NL----------------DDPERENDA---------QK----LTLLADAAEEL----GVFSPELAEAIKELWKDPGIQAC  140 (354)
T ss_pred             CC----------------CChhhhhHH---------HH----HHHhhhccccc----ccCCHHHHHHHHHHHcCHHHHHH
Confidence            32                122111110         00    1111 111111    45678999999999999999999


Q ss_pred             HhcccchhhcccchhhhhhcccccccCCCCCCccceeeeecccccCCeeEEEEEcCCCCCCCCccccccccccccEEEEE
Q 003444          672 YSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIR  751 (819)
Q Consensus       672 y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT~stGItE~eF~~~~~~~~~~~D~ggqr~~~l~frLiD  751 (819)
                      |+||+||+ |+|+|.|||+|++||++|+|+||++||||+|++|  +||+|+.|++++                ++|+++|
T Consensus       141 ~~r~~e~~-l~Dsa~Yfl~~l~rI~~~~Y~PT~~DIL~~R~~T--~GI~e~~F~~k~----------------~~f~~~D  201 (354)
T KOG0082|consen  141 YERRREFQ-LNDSAKYFLENLDRISSPDYVPTEQDILRSRVPT--TGIVEVEFTIKG----------------LKFRMFD  201 (354)
T ss_pred             HHcCCcCC-CCccHHHHHHhHHHhcCCCCCCCHHHHHhhccCc--CCeeEEEEEeCC----------------CceEEEe
Confidence            99999999 8999999999999999999999999999999998  699999999987                7999999


Q ss_pred             ecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          752 VQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       752 VGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      |||| |+||+||+||||+|+|||||||||+|||+++++.  .+|||+||++||++||||+||++|+||
T Consensus       202 vGGQ-RseRrKWihcFe~v~aviF~vslSeYdq~l~ED~--~~NRM~eS~~LF~sI~n~~~F~~tsii  266 (354)
T KOG0082|consen  202 VGGQ-RSERKKWIHCFEDVTAVIFCVSLSEYDQVLEEDE--TTNRMHESLKLFESICNNKWFANTSII  266 (354)
T ss_pred             CCCc-HHHhhhHHHhhcCCCEEEEEEehhhhhhhccccc--chhHHHHHHHHHHHHhcCcccccCcEE
Confidence            9999 9999999999999999999999999999965443  799999999999999999999999986


No 2  
>KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms]
Probab=100.00  E-value=1.1e-64  Score=516.92  Aligned_cols=265  Identities=26%  Similarity=0.457  Sum_probs=229.9

Q ss_pred             cccccccccccCCCCCCCCcccccccccccCch-hHHHhcceeeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhH
Q 003444          491 TKLVCAVLSLPVPSKSSNPGAEQGSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIK  569 (819)
Q Consensus       491 ~~~~c~~~Slp~p~~~~~~~a~~~S~~IDr~L~-dk~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K  569 (819)
                      +-|.|.+       .....++++++..|+|+|. |++..++++||||||+||||||||+|||||||+ .|||++++..++
T Consensus         5 ~~~~ccl-------see~ke~~ri~~eierql~rdkk~arrelkllllgtgesgkstfikqmriihg-~gyseedrkgf~   76 (359)
T KOG0085|consen    5 TWMCCCL-------SEEEKEAARINQEIERQLRRDKKDARRELKLLLLGTGESGKSTFIKQMRIIHG-AGYSEEDRKGFT   76 (359)
T ss_pred             hhhHhhC-------cHhHHHHHHHHHHHHHHHHHHhHhhhhhheeeeecCCCcchhhHHHHHHhhhc-CCCChhhhccch
Confidence            3466665       3445678899999999997 899999999999999999999999999999999 999999999999


Q ss_pred             HHHHHHHHHHHHHHHhhhccchhhHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhhhhcCCccccCc
Q 003444          570 LKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFP  649 (819)
Q Consensus       570 ~iIqsNIi~sm~iLLea~e~fe~e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~~~~g~ld~~fp  649 (819)
                      .+||.||+.+|+.+|+||+.+.+...                .+             .+|+-+..+.+.    +++. ..
T Consensus        77 ~lvyqnif~amqaMIrAMetL~I~y~----------------~e-------------~nk~~A~~vrev----d~ek-Vt  122 (359)
T KOG0085|consen   77 KLVYQNIFTAMQAMIRAMETLKIPYK----------------RE-------------ENKAHASLVREV----DVEK-VT  122 (359)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhccccc----------------cc-------------cchhhhhHhhhc----chHH-hh
Confidence            99999999999999999998877542                11             112222222221    1111 12


Q ss_pred             ccchhHHHHHHHHhcCHHHHHHHhcccchhhcccchhhhhhcccccccCCCCCCccceeeeecccccCCeeEEEEEcCCC
Q 003444          650 AATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRS  729 (819)
Q Consensus       650 ~~t~E~A~aI~eLWkDpgIQ~~y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT~stGItE~eF~~~~~  729 (819)
                      .+...|+.+|+.||.|||||+||+||+||| |.|||.|||.+++||+.|+|.||.||+||.|++|  |||.|+-|.+.. 
T Consensus       123 tfe~~yv~aik~LW~D~GIqeCYdRRREyq-LsDSakYylsdldria~~~ylPTqQDvLRvRvPT--TGi~eypfdl~~-  198 (359)
T KOG0085|consen  123 TFEKRYVSAIKWLWRDPGIQECYDRRREYQ-LSDSAKYYLSDLDRIATPGYLPTQQDVLRVRVPT--TGIIEYPFDLQK-  198 (359)
T ss_pred             hhhHHHHHHHHHHHhCcchHHHHHHHHHhh-cchhhhHHhhhhhhhcCcccCcchhhhheeecCc--ccceecCcchhh-
Confidence            345689999999999999999999999999 8999999999999999999999999999999999  699999998876 


Q ss_pred             CCCCCccccccccccccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhc
Q 003444          730 ASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVT  809 (819)
Q Consensus       730 ~~~~~~D~ggqr~~~l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~n  809 (819)
                                     +.|+++||||| ++||+||+|||++|++|||+|+||+|||++++.+  ..|||.||+.||.+|+.
T Consensus       199 ---------------iifrmvDvGGq-rserrKWIHCFEnvtsi~fLvaLSEYDQvL~E~d--nENRMeESkALFrTIi~  260 (359)
T KOG0085|consen  199 ---------------IIFRMVDVGGQ-RSERRKWIHCFENVTSIIFLVALSEYDQVLVESD--NENRMEESKALFRTIIT  260 (359)
T ss_pred             ---------------heeeeeecCCc-hhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHcc--chhhHHHHHHHHHHHhc
Confidence                           78999999999 9999999999999999999999999999975544  68999999999999999


Q ss_pred             cccccCCCCC
Q 003444          810 IQLLIRWNFF  819 (819)
Q Consensus       810 np~F~~t~f~  819 (819)
                      .|||++++.|
T Consensus       261 yPWF~nssVI  270 (359)
T KOG0085|consen  261 YPWFQNSSVI  270 (359)
T ss_pred             cccccCCceE
Confidence            9999999865


No 3  
>smart00275 G_alpha G protein alpha subunit. Subunit of G proteins that contains the guanine nucleotide binding site
Probab=100.00  E-value=6.1e-59  Score=501.77  Aligned_cols=252  Identities=29%  Similarity=0.477  Sum_probs=217.6

Q ss_pred             ccccccccCch-hHHHhcceeeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHHHHHHHHHHHHHHhhhccch
Q 003444          513 QGSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFE  591 (819)
Q Consensus       513 ~~S~~IDr~L~-dk~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iIqsNIi~sm~iLLea~e~fe  591 (819)
                      +.|+.||++|+ ++++.++.+||||||+||||||||+||||+||+ +||+++|++.||.+||.|++++|..||++++.++
T Consensus         2 ~~~~~Id~~l~~~~~~~~~~~klLLLG~geSGKSTi~KQmril~~-~gfs~~E~~~~~~~I~~Nii~~~~~ll~a~~~~~   80 (342)
T smart00275        2 RRNKEIEKQLEEERKKKKREVKLLLLGAGESGKSTILKQMRILHG-DGFSQEERREYRPLIYSNILESMKALVDAMEELN   80 (342)
T ss_pred             cchHHHHHHHHHhHHHhhcchheeeeecCCCcchhHHHHHHHhhc-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcC
Confidence            46789999997 888889999999999999999999999999999 8999999999999999999999999999998776


Q ss_pred             hhHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhhhh-cCCccccCcccchhHHHHHHHHhcCHHHHH
Q 003444          592 EEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMV-SGNLEAIFPAATREYSPLVEELWKDAAIQA  670 (819)
Q Consensus       592 ~e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~~~-~g~ld~~fp~~t~E~A~aI~eLWkDpgIQ~  670 (819)
                      ++..                ++.+             ...++.++.... ....+   ..++.++++.|..||+||+||+
T Consensus        81 i~~~----------------~~~~-------------~~~~~~~~~~~~~~~~~~---~~~~~e~~~~i~~LW~D~~iq~  128 (342)
T smart00275       81 IPFE----------------DPES-------------ILDIRIITEQFNKTDETE---NVLPKEIAKAIKALWKDEGIQE  128 (342)
T ss_pred             CCCC----------------Chhh-------------HHHHHHHhcccccccccc---ccCCHHHHHHHHHHHCCHHHHH
Confidence            5431                1100             000111111100 00111   1245799999999999999999


Q ss_pred             HHhcccchhhcccchhhhhhcccccccCCCCCCccceeeeecccccCCeeEEEEEcCCCCCCCCccccccccccccEEEE
Q 003444          671 TYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLI  750 (819)
Q Consensus       671 ~y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT~stGItE~eF~~~~~~~~~~~D~ggqr~~~l~frLi  750 (819)
                      ||+||++|+ |+|++.|||++++||++|+|+||++||||+|.+|  +||.+..|.++.                +.|++|
T Consensus       129 ~~~~~~~~~-l~ds~~yf~~~~~ri~~~~y~Pt~~Dil~~r~~T--~Gi~~~~f~~~~----------------~~~~~~  189 (342)
T smart00275      129 CYRRRNEFQ-LNDSASYFLDNIDRIGDPDYVPTEQDILRSRVPT--TGIQETAFIVKK----------------LFFRMF  189 (342)
T ss_pred             HHHhccccc-cccchhHHHHHHHHHhCCCCCCCHHHhhheeCCc--cceEEEEEEECC----------------eEEEEE
Confidence            999999998 8999999999999999999999999999999999  699999999976                689999


Q ss_pred             EecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          751 RVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       751 DVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      ||||| +++|+||.|||++|++||||||+|+|||++++++  .+|||+||+.+|+++|+++||+++||+
T Consensus       190 DvgGq-r~~R~kW~~~f~~v~~IiFvvdlSd~d~~~~Ed~--~~nrl~esl~~f~~l~~~~~~~~~pii  255 (342)
T smart00275      190 DVGGQ-RSERKKWIHCFDNVTAIIFCVALSEYDQVLEEDE--STNRMQESLNLFESICNSRWFANTSII  255 (342)
T ss_pred             ecCCc-hhhhhhHHHHhCCCCEEEEEEECcccccchhccC--cchHHHHHHHHHHHHHcCccccCCcEE
Confidence            99999 9999999999999999999999999999964443  699999999999999999999999985


No 4  
>PF00503 G-alpha:  G-protein alpha subunit;  InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) []. G proteins and their receptors (GPCRs) form one of the most prevalent signalling systems in mammalian cells, regulating systems as diverse as sensory perception, cell growth and hormonal regulation []. At the cell surface, the binding of ligands such as hormones and neurotransmitters to a GPCR activates the receptor by causing a conformational change, which in turn activates the bound G protein on the intracellular-side of the membrane. The activated receptor promotes the exchange of bound GDP for GTP on the G protein alpha subunit. GTP binding changes the conformation of switch regions within the alpha subunit, which allows the bound trimeric G protein (inactive) to be released from the receptor, and to dissociate into active alpha subunit (GTP-bound) and beta/gamma dimer. The alpha subunit and the beta/gamma dimer go on to activate distinct downstream effectors, such as adenylyl cyclase, phosphodiesterases, phospholipase C, and ion channels. These effectors in turn regulate the intracellular concentrations of secondary messengers, such as cAMP, diacylglycerol, sodium or calcium cations, which ultimately lead to a physiological response, usually via the downstream regulation of gene transcription. The cycle is completed by the hydrolysis of alpha subunit-bound GTP to GDP, resulting in the re-association of the alpha and beta/gamma subunits and their binding to the receptor, which terminates the signal []. The length of the G protein signal is controlled by the duration of the GTP-bound alpha subunit, which can be regulated by RGS (regulator of G protein signalling) proteins (IPR000342 from INTERPRO) or by covalent modifications []. There are several isoforms of each subunit, many of which have splice variants, which together can make up hundreds of combinations of G proteins. The specific combination of subunits in heterotrimeric G proteins affects not only which receptor it can bind to, but also which downstream target is affected, providing the means to target specific physiological processes in response to specific external stimuli [, ]. G proteins carry lipid modifications on one or more of their subunits to target them to the plasma membrane and to contribute to protein interactions. This family consists of the G protein alpha subunit, which acts as a weak GTPase. G protein classes are defined based on the sequence and function of their alpha subunits, which in mammals fall into four main categories: G(S)alpha, G(Q)alpha, G(I)alpha and G(12)alpha; there are also fungal and plant classes of alpha subunits. The alpha subunit consists of two domains: a GTP-binding domain and a helical insertion domain (IPR011025 from INTERPRO). The GTP-binding domain is homologous to Ras-like small GTPases, and includes switch regions I and II, which change conformation during activation. The switch regions are loops of alpha-helices with conformations sensitive to guanine nucleotides. The helical insertion domain is inserted into the GTP-binding domain before switch region I and is unique to heterotrimeric G proteins. This helical insertion domain functions to sequester the guanine nucleotide at the interface with the GTP-binding domain and must be displaced to enable nucleotide dissociation.; GO: 0004871 signal transducer activity, 0019001 guanyl nucleotide binding, 0007186 G-protein coupled receptor protein signaling pathway; PDB: 3QI2_B 3QE0_A 2IK8_A 2OM2_A 2GTP_B 2XNS_B 3ONW_B 1KJY_A 2EBC_A 1Y3A_B ....
Probab=100.00  E-value=1.2e-58  Score=504.09  Aligned_cols=260  Identities=32%  Similarity=0.469  Sum_probs=206.2

Q ss_pred             ccccccccCch-hHHHhcceeeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHHHHHHHHHHHHHHhhhccch
Q 003444          513 QGSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFE  591 (819)
Q Consensus       513 ~~S~~IDr~L~-dk~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iIqsNIi~sm~iLLea~e~fe  591 (819)
                      ..++.|+++++ ++++.++.+||||||+||||||||+||||++|+ ++|+++|+..|+.+|+.|++++|+.|++++..++
T Consensus        39 ~~~~~~~~~l~~~~~~~~~~~kiLLLG~geSGKSTi~KQ~ril~~-~~~~~~E~~~~~~~I~~Nii~~~~~i~~~~~~~~  117 (389)
T PF00503_consen   39 KRSDDIDRQLEKDKKRSKREIKILLLGSGESGKSTILKQMRILYG-PGFSEEERESYRPIIYSNIIQSMKQILEALEELG  117 (389)
T ss_dssp             HHHHHHHHHHHHHHHHHHEEEEEEEEESTTSSHHHHHHHHHHHHS-T---HHHHHHTHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HhhHHHHHHHHHHHHhhhccceEEEECCCCcchhhHHHHHHHHhC-CCCchhhhhcceeeEecCchhhHHHHHHHHHHcC
Confidence            34677778776 788889999999999999999999999999999 8999999999999999999999999999998877


Q ss_pred             hhHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhhhhcCCccccCc------ccchhHHHHHHHHhcC
Q 003444          592 EEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFP------AATREYSPLVEELWKD  665 (819)
Q Consensus       592 ~e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~~~~g~ld~~fp------~~t~E~A~aI~eLWkD  665 (819)
                      ++...              ... ..       ..+.......-+....... ....++      .++.++++.|..||+|
T Consensus       118 ~~~~~--------------~~~-~~-------~~~~~~~~~~~l~~~~~~~-~~~~~~~~~~~~~~~~~~~~~i~~LW~D  174 (389)
T PF00503_consen  118 IPFSF--------------SES-SQ-------LNEENQEIAEKLKEILDPL-DSSEFSLASDDNKFPEELAEDIRSLWKD  174 (389)
T ss_dssp             CH-SS--------------S-T-T---------STTHHHHHHHHHHHHCTT-STTCTC-----HCHHHHHHHHHHHHHHS
T ss_pred             CCccc--------------ccc-cc-------CCHHHHHHHHHHHhhhccc-cccccccccccccCCHHHHHHHHHHHCC
Confidence            65310              000 00       0011111222222222111 111111      2567999999999999


Q ss_pred             HHHHHHHhcccchhhcccchhhhhhcccccccCCCCCCccceeeeecccccCCeeEEEEEc-CCCCCCCCcccccccccc
Q 003444          666 AAIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSF-PRSASDDSVDTADQHDSL  744 (819)
Q Consensus       666 pgIQ~~y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT~stGItE~eF~~-~~~~~~~~~D~ggqr~~~  744 (819)
                      |+||++|+++++|+ |+|++.|||++++||++++|+||++||||+|.+|  +||.|+.|.+ ..                
T Consensus       175 ~~vq~~~~~~~~~~-l~d~~~YFl~~l~RI~~~~Y~PT~~DIl~~r~~T--~Gi~e~~f~~~~~----------------  235 (389)
T PF00503_consen  175 PGVQECYERRNEFQ-LPDNAKYFLDNLDRIAQPDYIPTDEDILRCRVKT--TGITEIDFNFSGS----------------  235 (389)
T ss_dssp             HHHHHHHGGGGGST---TTHHHHHTTHHHHHSTTB---HHHHHHS------SSEEEEEEEE-TT----------------
T ss_pred             hhHHHHHHhhhccc-ccccHHHHhhhhhhhcCCCccCCCCCeeeecCCC--CCeeEEEEEeecc----------------
Confidence            99999999999998 7999999999999999999999999999999998  6999999999 54                


Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCccccc-ccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFS-VDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~l-ED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      ..|+|+||||| ++||+||+|||++|++||||||||+|||++ ||.   .+|||+|||.||++|||+|||++++||
T Consensus       236 ~~~~~~DvGGq-r~eRkKW~~~F~~v~~vif~vsls~ydq~~~ed~---~~nrl~esl~lF~~i~~~~~~~~~~ii  307 (389)
T PF00503_consen  236 RKFRLIDVGGQ-RSERKKWIHCFEDVTAVIFVVSLSEYDQTLYEDP---NTNRLHESLNLFESICNNPWFKNTPII  307 (389)
T ss_dssp             EEEEEEEETSS-GGGGGGGGGGGTTESEEEEEEEGGGGGSBESSST---TSBHHHHHHHHHHHHHTSGGGTTSEEE
T ss_pred             cccceecCCCC-chhhhhHHHHhccccEEEEeecccchhhhhcccc---hHHHHHHHHHHHHHHHhCcccccCceE
Confidence            79999999999 999999999999999999999999999995 666   699999999999999999999999885


No 5  
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms]
Probab=100.00  E-value=4.3e-59  Score=481.90  Aligned_cols=256  Identities=27%  Similarity=0.450  Sum_probs=226.2

Q ss_pred             CCcccccccccccCch-hHHHhcceeeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHHHHHHHHHHHHHHhh
Q 003444          508 NPGAEQGSGLMSRSVP-DYIERRTLQKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEG  586 (819)
Q Consensus       508 ~~~a~~~S~~IDr~L~-dk~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iIqsNIi~sm~iLLea  586 (819)
                      ...++.+|+.|+++|+ ++.-.+..+||||||+||||||||+|||||||- +||+++|+..--+-|+.||-.+|..|+.+
T Consensus        16 ~~~q~~~s~~i~~ql~~~k~~~~aThrlLLLGagESGKsTIvKQMRILHv-nGF~~~EkreKI~dI~~Ni~eai~~iv~a   94 (379)
T KOG0099|consen   16 EKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQMRILHV-NGFNDEEKREKIQDIKNNIKEAILTIVGA   94 (379)
T ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHhHHhheeccccccchhhhhhhheeee-cCCChHHHHHhhHHHHHHHHHHHHHHHHH
Confidence            3455678999999998 899999999999999999999999999999999 99999999999999999999999999999


Q ss_pred             hccchhhHHHhhhhcCCCCCCCCCCCCCCCCCcceeccchhhHHhHHHHHhhhhcCCccccCcccchhHHHHHHHHhcCH
Q 003444          587 RERFEEEILGEKRKKQSSDETNPVGSSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDA  666 (819)
Q Consensus       587 ~e~fe~e~l~e~r~~~spde~~~~g~~~~~~~~~Iysi~~rlk~fsdwll~~~~~g~ld~~fp~~t~E~A~aI~eLWkDp  666 (819)
                      |..+..+.              +++++++             ..-+|++++++...  +..+   .+|+.+.+.+||+|.
T Consensus        95 M~~l~p~v--------------~l~~~~~-------------~~~~dYIls~~~~~--~~~~---~~Ef~dHv~~lW~D~  142 (379)
T KOG0099|consen   95 MSNLVPPV--------------ELANPEN-------------QFRVDYILSVMNSP--DFDY---PPEFYDHVKTLWEDE  142 (379)
T ss_pred             HhccCCCc--------------ccCCccc-------------chhHHHHHhcCCCC--cccC---CHHHHHHHHHHhhhh
Confidence            88765332              2344321             11246777775432  3233   469999999999999


Q ss_pred             HHHHHHhcccchhhcccchhhhhhcccccccCCCCCCccceeeeecccccCCeeEEEEEcCCCCCCCCcccccccccccc
Q 003444          667 AIQATYSRRSELEMLSSVASYFLERVVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLR  746 (819)
Q Consensus       667 gIQ~~y~RRnEfq~LpDSA~YFLdnIdRIaspDYvPTdqDILraR~kT~stGItE~eF~~~~~~~~~~~D~ggqr~~~l~  746 (819)
                      ||++||+|+|||| |-|+|.|||+++++|.+++|+||+|||||+|+.|  +||.|+.|.++.                .+
T Consensus       143 Gv~acyeRSnEyq-LiDcAqYFLd~~~~i~~~~Y~Ps~qDiLrcRvlT--sGIfet~FqVdk----------------v~  203 (379)
T KOG0099|consen  143 GVRACYERSNEYQ-LIDCAQYFLDKIDVIKQADYVPSDQDILRCRVLT--SGIFETKFQVDK----------------VN  203 (379)
T ss_pred             hHHHHHhccCccc-hhhHHHHHHHhhheecccCCCCcHHHHHHhhhhc--cceeeEEEeccc----------------cc
Confidence            9999999999999 6799999999999999999999999999999999  699999999987                68


Q ss_pred             EEEEEecccccccccccccccCCCCEEEEEEeCCCccccc-ccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          747 YQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFS-VDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       747 frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~l-ED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      |+|+||||| |-||+||++||++|+||||+++.|+||+++ ||.   .+|||.|||+||++|+||+|++...+|
T Consensus       204 FhMfDVGGQ-RDeRrKWIQcFndvtAiifv~acSsyn~vlrED~---~qNRL~EaL~LFksiWnNRwL~tisvI  273 (379)
T KOG0099|consen  204 FHMFDVGGQ-RDERRKWIQCFNDVTAIIFVVACSSYNMVLREDN---QQNRLQEALNLFKSIWNNRWLRTISVI  273 (379)
T ss_pred             eeeeccCCc-hhhhhhHHHHhcCccEEEEEEeccchhhhhhcCC---chhHHHHHHHHHHHHHhhhHHhhhhee
Confidence            999999999 999999999999999999999999999996 666   799999999999999999999887664


No 6  
>cd00066 G-alpha G protein alpha subunit.  The alpha subunit of G proteins contains the guanine nucleotide binding site. The heterotrimeric GNP-binding proteins are signal transducers that communicate signals from many hormones, neurotransmitters, chemokines, and autocrine and paracrine factors. Extracellular signals are received by receptors, which activate the G proteins, which in turn route the signals to several distinct intracellular signaling pathways. The alpha subunit of G proteins is a weak GTPase. In the resting state, heterotrimeric G proteins are associated at the cytosolic face of the plasma membrane and the alpha subunit binds to GDP. Upon activation by a receptor GDP is replaced with GTP, and the G-alpha/GTP complex dissociates from the beta and gamma subunits. This results in activation of downstream signaling pathways, such as cAMP synthesis by adenylyl cyclase, which is terminated when GTP is hydrolized and the heterotrimers reconstitute.
Probab=100.00  E-value=7.9e-57  Score=480.10  Aligned_cols=231  Identities=35%  Similarity=0.511  Sum_probs=202.1

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHHHHHHHHHHHHHHhhhccchhhHHHhhhhcCCCCCCCCCC
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKIQSNAYGYLGILLEGRERFEEEILGEKRKKQSSDETNPVG  611 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iIqsNIi~sm~iLLea~e~fe~e~l~e~r~~~spde~~~~g  611 (819)
                      +||||||+||||||||+|||||||+ +||+++||+.||.+||.||+++|+.||++++.++++..                
T Consensus         1 ~klLlLG~geSGKSTi~KQmril~~-~gfs~~Er~~~~~~I~~Ni~~~~~~ll~a~~~~~i~~~----------------   63 (317)
T cd00066           1 VKLLLLGAGESGKSTILKQMKILHG-DGFSEEELREYRPVIYSNILQSMKALLEAMERLNIPFG----------------   63 (317)
T ss_pred             CeEEEecCCCccHHHHHHHHHHhcC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCC----------------
Confidence            6999999999999999999999999 99999999999999999999999999999998775421                


Q ss_pred             CCCCCCCcceeccchhhHHhHHHHHhhhhcCCccccCcccchhHHHHHHHHhcCHHHHHHHhcccchhhcccchhhhhhc
Q 003444          612 SSDSTDGKTIYTIGPRLKAFSDWLLKTMVSGNLEAIFPAATREYSPLVEELWKDAAIQATYSRRSELEMLSSVASYFLER  691 (819)
Q Consensus       612 ~~~~~~~~~Iysi~~rlk~fsdwll~~~~~g~ld~~fp~~t~E~A~aI~eLWkDpgIQ~~y~RRnEfq~LpDSA~YFLdn  691 (819)
                      .+.             ....+++++....    ....+.+++++++.|.+||+|++||+||+||++|+ |+|++.|||++
T Consensus        64 ~~~-------------~~~~~~~i~~~~~----~~~~~~~~~~~~~~i~~lW~d~~iq~~~~~r~e~~-l~d~~~yf~~~  125 (317)
T cd00066          64 DPE-------------NEKDAKKILSFAP----ELEEGELPPELAEAIKELWKDPGIQACYDRRNEFQ-LNDSAKYFLDN  125 (317)
T ss_pred             Chh-------------hHHHHHHHHhccc----cccccCCCHHHHHHHHHHhCCHHHHHHHHhccccc-cccchHHHHHh
Confidence            110             0111222222211    00122356799999999999999999999999998 89999999999


Q ss_pred             ccccccCCCCCCccceeeeecccccCCeeEEEEEcCCCCCCCCccccccccccccEEEEEecccccccccccccccCCCC
Q 003444          692 VVDISRTDYEPSDLDILYAEGVTSSNGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIG  771 (819)
Q Consensus       692 IdRIaspDYvPTdqDILraR~kT~stGItE~eF~~~~~~~~~~~D~ggqr~~~l~frLiDVGGQgrsERkKWi~~FEdVt  771 (819)
                      ++||++|+|+||++||||+|.+|  +||.|+.|.++.                +.|++|||||| +++|+||.|||++|+
T Consensus       126 ~~ri~~~~y~Pt~~Dil~~r~~T--~Gi~~~~f~~~~----------------~~~~~~DvgGq-~~~R~kW~~~f~~v~  186 (317)
T cd00066         126 LDRISDPDYIPTEQDILRARVKT--TGIVETKFTIKN----------------LKFRMFDVGGQ-RSERKKWIHCFEDVT  186 (317)
T ss_pred             HHHHhCCCCCCChhHheeeeccc--CCeeEEEEEecc----------------eEEEEECCCCC-cccchhHHHHhCCCC
Confidence            99999999999999999999999  699999999976                78999999999 999999999999999


Q ss_pred             EEEEEEeCCCccccc-ccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          772 MVIFCVALSDYDQFS-VDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       772 aVIFvVSLSdYDQ~l-ED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      +||||||+|+|||.+ ||.   .+|||+||+++|+++|+++||+++|++
T Consensus       187 ~iifvv~lsd~d~~~~e~~---~~nrl~esl~~f~~i~~~~~~~~~pil  232 (317)
T cd00066         187 AIIFVVALSEYDQVLFEDE---STNRMQESLNLFDSICNSRWFANTSII  232 (317)
T ss_pred             EEEEEEEchhcccccccCC---cchHHHHHHHHHHHHHhCccccCCCEE
Confidence            999999999999995 555   699999999999999999999999975


No 7  
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=98.49  E-value=3.7e-07  Score=89.92  Aligned_cols=73  Identities=12%  Similarity=0.210  Sum_probs=64.4

Q ss_pred             CCeeEEEEEcCCCCCCCCccccccccccccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccch
Q 003444          717 NGLACVDFSFPRSASDDSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNK  796 (819)
Q Consensus       717 tGItE~eF~~~~~~~~~~~D~ggqr~~~l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NR  796 (819)
                      .|.....+.+.+                .++.+||+||+ ..-|.-|.+||.++++||||||.++            .+|
T Consensus        46 ~g~~~~~i~~~~----------------~~~~~~d~gG~-~~~~~~w~~y~~~~~~iIfVvDssd------------~~~   96 (175)
T PF00025_consen   46 IGFNIEEIKYKG----------------YSLTIWDLGGQ-ESFRPLWKSYFQNADGIIFVVDSSD------------PER   96 (175)
T ss_dssp             SSEEEEEEEETT----------------EEEEEEEESSS-GGGGGGGGGGHTTESEEEEEEETTG------------GGG
T ss_pred             cccccceeeeCc----------------EEEEEEecccc-ccccccceeeccccceeEEEEeccc------------cee
Confidence            477777777765                68999999998 7889999999999999999999994            469


Q ss_pred             HHHHHHHHHHHhccccccCCCC
Q 003444          797 MMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       797 M~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      |.||.+.|..+++++.++++||
T Consensus        97 l~e~~~~L~~ll~~~~~~~~pi  118 (175)
T PF00025_consen   97 LQEAKEELKELLNDPELKDIPI  118 (175)
T ss_dssp             HHHHHHHHHHHHTSGGGTTSEE
T ss_pred             ecccccchhhhcchhhcccceE
Confidence            9999999999999998888775


No 8  
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport]
Probab=98.49  E-value=1.6e-07  Score=92.09  Aligned_cols=62  Identities=13%  Similarity=0.182  Sum_probs=56.8

Q ss_pred             cccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          744 LLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       744 ~l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ..+|.+|||||| ..-|..|.|||.+.+++|||+|.++            .|||+|+++-..+|+++|-+.+.+|
T Consensus        60 N~kfNvwdvGGq-d~iRplWrhYy~gtqglIFV~Dsa~------------~dr~eeAr~ELh~ii~~~em~~~~~  121 (180)
T KOG0071|consen   60 NVKFNVWDVGGQ-DKIRPLWRHYYTGTQGLIFVVDSAD------------RDRIEEARNELHRIINDREMRDAII  121 (180)
T ss_pred             eeEEeeeeccCc-hhhhHHHHhhccCCceEEEEEeccc------------hhhHHHHHHHHHHHhCCHhhhcceE
Confidence            378999999999 7899999999999999999999885            4999999999999999998877765


No 9  
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=98.29  E-value=1.3e-06  Score=88.59  Aligned_cols=61  Identities=15%  Similarity=0.223  Sum_probs=54.3

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ++|++|||||| ..-|.-|.|||.+.++||||||.+|            .-||.|+.+-+..+.+++-+.++|+
T Consensus        61 ~~f~vWDvGGq-~k~R~lW~~Y~~~t~~lIfVvDS~D------------r~Ri~eak~eL~~~l~~~~l~~~~l  121 (181)
T KOG0070|consen   61 ISFTVWDVGGQ-EKLRPLWKHYFQNTQGLIFVVDSSD------------RERIEEAKEELHRMLAEPELRNAPL  121 (181)
T ss_pred             eEEEEEecCCC-cccccchhhhccCCcEEEEEEeCCc------------HHHHHHHHHHHHHHHcCcccCCceE
Confidence            79999999999 8899999999999999999999985            4688899998989988887666654


No 10 
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=97.99  E-value=7.7e-06  Score=82.14  Aligned_cols=60  Identities=17%  Similarity=0.202  Sum_probs=51.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWN  817 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~  817 (819)
                      .++.+|||||| +.-|.-|.+||+.++++|||||+||            .-||.|.......++...-++-++
T Consensus        60 ~~L~iwDvGGq-~~lr~~W~nYfestdglIwvvDssD------------~~r~~e~~~~L~~lL~eerlaG~~  119 (185)
T KOG0073|consen   60 YTLNIWDVGGQ-KTLRSYWKNYFESTDGLIWVVDSSD------------RMRMQECKQELTELLVEERLAGAP  119 (185)
T ss_pred             eEEEEEEcCCc-chhHHHHHHhhhccCeEEEEEECch------------HHHHHHHHHHHHHHHhhhhhcCCc
Confidence            68999999999 8999999999999999999999985            368888888888887766555544


No 11 
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=97.94  E-value=1.7e-05  Score=78.46  Aligned_cols=89  Identities=15%  Similarity=0.184  Sum_probs=60.1

Q ss_pred             cccCCeeEEEEEcCCCCCC-----CCccccccccccccEEEEEecccccccccccccccCCCCEEEEEEeCCCccccccc
Q 003444          714 TSSNGLACVDFSFPRSASD-----DSVDTADQHDSLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVD  788 (819)
Q Consensus       714 T~stGItE~eF~~~~~~~~-----~~~D~ggqr~~~l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED  788 (819)
                      +-++|++-+.|........     --+.+....-++++|++||+||| .+-|..|..||+|+++||||||.+|-||    
T Consensus        26 ldGaGkttIlyrlqvgevvttkPtigfnve~v~yKNLk~~vwdLggq-tSirPyWRcYy~dt~avIyVVDssd~dr----  100 (182)
T KOG0072|consen   26 LDGAGKTTILYRLQVGEVVTTKPTIGFNVETVPYKNLKFQVWDLGGQ-TSIRPYWRCYYADTDAVIYVVDSSDRDR----  100 (182)
T ss_pred             ccCCCeeEEEEEcccCcccccCCCCCcCccccccccccceeeEccCc-ccccHHHHHHhcccceEEEEEeccchhh----
Confidence            3345777666665432111     11222222225689999999999 7999999999999999999999998665    


Q ss_pred             CCCCccchHHHHHHHHHHHhccccccC
Q 003444          789 GNGSLMNKMMLSRKFFESIVTIQLLIR  815 (819)
Q Consensus       789 ~~G~~~NRM~ESL~LFEsI~nnp~F~~  815 (819)
                              +--|..+|-+++..+-++.
T Consensus       101 --------is~a~~el~~mL~E~eLq~  119 (182)
T KOG0072|consen  101 --------ISIAGVELYSMLQEEELQH  119 (182)
T ss_pred             --------hhhhHHHHHHHhccHhhcC
Confidence                    4455556666665554444


No 12 
>PLN00223 ADP-ribosylation factor; Provisional
Probab=97.64  E-value=6.5e-05  Score=74.42  Aligned_cols=62  Identities=15%  Similarity=0.240  Sum_probs=51.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNFF  819 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f~  819 (819)
                      +.+++||++|| ...+..|.++|.++++||||+|+++.            .++.++.+.+..+++...+.+.|++
T Consensus        61 ~~~~i~D~~Gq-~~~~~~~~~~~~~a~~iI~V~D~s~~------------~s~~~~~~~l~~~l~~~~~~~~pii  122 (181)
T PLN00223         61 ISFTVWDVGGQ-DKIRPLWRHYFQNTQGLIFVVDSNDR------------DRVVEARDELHRMLNEDELRDAVLL  122 (181)
T ss_pred             EEEEEEECCCC-HHHHHHHHHHhccCCEEEEEEeCCcH------------HHHHHHHHHHHHHhcCHhhCCCCEE
Confidence            68999999998 67888999999999999999999863            3566777778888877777666653


No 13 
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only]
Probab=97.52  E-value=0.0001  Score=72.99  Aligned_cols=36  Identities=14%  Similarity=0.419  Sum_probs=33.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ++..+|||||| ++-|.-|.+||++|+.+|||+|..|
T Consensus        62 f~LnvwDiGGq-r~IRpyWsNYyenvd~lIyVIDS~D   97 (185)
T KOG0074|consen   62 FHLNVWDIGGQ-RGIRPYWSNYYENVDGLIYVIDSTD   97 (185)
T ss_pred             EEEEEEecCCc-cccchhhhhhhhccceEEEEEeCCc
Confidence            68899999999 9999999999999999999999654


No 14 
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=97.36  E-value=0.00028  Score=69.12  Aligned_cols=61  Identities=13%  Similarity=0.191  Sum_probs=48.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      +.+++||++|+ ...+..|.+||.++++||||+|+++            ..++.++.+.+..+.+...+.+.|+
T Consensus        57 ~~l~l~D~~G~-~~~~~~~~~~~~~ad~ii~v~D~t~------------~~s~~~~~~~l~~~~~~~~~~~~pi  117 (175)
T smart00177       57 ISFTVWDVGGQ-DKIRPLWRHYYTNTQGLIFVVDSND------------RDRIDEAREELHRMLNEDELRDAVI  117 (175)
T ss_pred             EEEEEEECCCC-hhhHHHHHHHhCCCCEEEEEEECCC------------HHHHHHHHHHHHHHhhCHhhcCCcE
Confidence            68999999998 6778899999999999999999885            2456677777777776655555554


No 15 
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=97.32  E-value=0.00035  Score=67.81  Aligned_cols=61  Identities=8%  Similarity=0.180  Sum_probs=50.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      .++++||++|+ ...+..|.++|.++++||||+|.++            ..++.++...+..+.+++.+.+.|+
T Consensus        43 ~~~~i~D~~G~-~~~~~~~~~~~~~a~~ii~V~D~s~------------~~s~~~~~~~l~~l~~~~~~~~~pi  103 (167)
T cd04161          43 YEVCIFDLGGG-ANFRGIWVNYYAEAHGLVFVVDSSD------------DDRVQEVKEILRELLQHPRVSGKPI  103 (167)
T ss_pred             EEEEEEECCCc-HHHHHHHHHHHcCCCEEEEEEECCc------------hhHHHHHHHHHHHHHcCccccCCcE
Confidence            68999999998 5678889999999999999999885            2467788888888887766666665


No 16 
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=97.30  E-value=0.00033  Score=67.41  Aligned_cols=61  Identities=15%  Similarity=0.214  Sum_probs=50.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      +.+++||++|| ...+..|.++|.+++++|||+|+++            .+++.++.+.|.+++.++.+.+.|+
T Consensus        44 ~~~~l~D~~G~-~~~~~~~~~~~~~ad~~i~v~D~~~------------~~s~~~~~~~~~~~~~~~~~~~~pi  104 (159)
T cd04150          44 ISFTVWDVGGQ-DKIRPLWRHYFQNTQGLIFVVDSND------------RERIGEAREELQRMLNEDELRDAVL  104 (159)
T ss_pred             EEEEEEECCCC-HhHHHHHHHHhcCCCEEEEEEeCCC------------HHHHHHHHHHHHHHHhcHHhcCCCE
Confidence            68999999998 5677889999999999999999885            2467777788888887766666665


No 17 
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=97.25  E-value=0.0004  Score=67.67  Aligned_cols=61  Identities=13%  Similarity=0.203  Sum_probs=48.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      .++++||++|+ ...+..|.++|.+++++|||+|+++.            ..+.+....+..+++++.+.+.|+
T Consensus        53 ~~~~l~Dt~G~-~~~~~~~~~~~~~a~~ii~v~D~t~~------------~s~~~~~~~~~~~~~~~~~~~~pi  113 (168)
T cd04149          53 VKFNVWDVGGQ-DKIRPLWRHYYTGTQGLIFVVDSADR------------DRIDEARQELHRIINDREMRDALL  113 (168)
T ss_pred             EEEEEEECCCC-HHHHHHHHHHhccCCEEEEEEeCCch------------hhHHHHHHHHHHHhcCHhhcCCcE
Confidence            68999999998 66778899999999999999998852            356677777777777665555554


No 18 
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport]
Probab=97.18  E-value=0.00024  Score=72.29  Aligned_cols=61  Identities=13%  Similarity=0.162  Sum_probs=55.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ....+||+||| .+.|.-|..||..+++|||++|.++            .-||.++...|+.++.|.-..++|+
T Consensus        69 ~~l~fwdlgGQ-e~lrSlw~~yY~~~H~ii~viDa~~------------~eR~~~~~t~~~~v~~~E~leg~p~  129 (197)
T KOG0076|consen   69 APLSFWDLGGQ-ESLRSLWKKYYWLAHGIIYVIDATD------------RERFEESKTAFEKVVENEKLEGAPV  129 (197)
T ss_pred             ceeEEEEcCCh-HHHHHHHHHHHHHhceeEEeecCCC------------HHHHHHHHHHHHHHHHHHHhcCCch
Confidence            47889999999 8999999999999999999999773            4699999999999999988888775


No 19 
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only]
Probab=97.13  E-value=0.0006  Score=68.05  Aligned_cols=60  Identities=15%  Similarity=0.237  Sum_probs=46.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWN  817 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~  817 (819)
                      +..++||+||| +..|..|-.|+..|++|+||||.+|-+            ++.-|+.-..+++..|-+...|
T Consensus        65 vtiklwD~gGq-~rfrsmWerycR~v~aivY~VDaad~~------------k~~~sr~EL~~LL~k~~l~gip  124 (186)
T KOG0075|consen   65 VTIKLWDLGGQ-PRFRSMWERYCRGVSAIVYVVDAADPD------------KLEASRSELHDLLDKPSLTGIP  124 (186)
T ss_pred             eEEEEEecCCC-ccHHHHHHHHhhcCcEEEEEeecCCcc------------cchhhHHHHHHHhcchhhcCCc
Confidence            78999999999 889999999999999999999999733            3344555555555555544443


No 20 
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=97.11  E-value=0.00066  Score=67.25  Aligned_cols=61  Identities=16%  Similarity=0.248  Sum_probs=48.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      +.+++||++|+ ...+..|.++|.+++++|||+|+++.            +++.++...+..+++...+.+.|+
T Consensus        61 ~~~~l~D~~G~-~~~~~~~~~~~~~ad~iI~v~D~t~~------------~s~~~~~~~l~~~~~~~~~~~~pi  121 (182)
T PTZ00133         61 LKFTMWDVGGQ-DKLRPLWRHYYQNTNGLIFVVDSNDR------------ERIGDAREELERMLSEDELRDAVL  121 (182)
T ss_pred             EEEEEEECCCC-HhHHHHHHHHhcCCCEEEEEEeCCCH------------HHHHHHHHHHHHHHhCHhhcCCCE
Confidence            68999999998 67778899999999999999998852            456666677777777665666554


No 21 
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=97.11  E-value=0.00097  Score=64.56  Aligned_cols=61  Identities=15%  Similarity=0.217  Sum_probs=46.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      .++++||++|+ ...+..|.++|.+++++|||+|+++.            +++.++...+..+.++..+.+.|+
T Consensus        43 ~~i~l~Dt~G~-~~~~~~~~~~~~~ad~ii~V~D~s~~------------~s~~~~~~~~~~~~~~~~~~~~pi  103 (169)
T cd04158          43 LKFTIWDVGGK-HKLRPLWKHYYLNTQAVVFVVDSSHR------------DRVSEAHSELAKLLTEKELRDALL  103 (169)
T ss_pred             EEEEEEECCCC-hhcchHHHHHhccCCEEEEEEeCCcH------------HHHHHHHHHHHHHhcChhhCCCCE
Confidence            68999999998 66788999999999999999999863            455566666666666544444443


No 22 
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=96.97  E-value=0.0011  Score=65.63  Aligned_cols=61  Identities=11%  Similarity=0.331  Sum_probs=48.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      .++.+||++|+ ...+..|.++|.++++||||+|.++.            .++.++...+..+++...+.+.|+
T Consensus        61 ~~~~~~D~~G~-~~~~~~~~~~~~~ad~ii~vvD~~~~------------~~~~~~~~~l~~l~~~~~~~~~pi  121 (184)
T smart00178       61 IKFTTFDLGGH-QQARRLWKDYFPEVNGIVYLVDAYDK------------ERFAESKRELDALLSDEELATVPF  121 (184)
T ss_pred             EEEEEEECCCC-HHHHHHHHHHhCCCCEEEEEEECCcH------------HHHHHHHHHHHHHHcChhhcCCCE
Confidence            57899999998 66788999999999999999999853            456666667777776655556554


No 23 
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=96.82  E-value=0.0021  Score=60.48  Aligned_cols=56  Identities=14%  Similarity=0.293  Sum_probs=42.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLL  813 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F  813 (819)
                      .++++||++|+ ...+..|..+|.+++++|||+|.++.            +++..+...++.+.+++++
T Consensus        45 ~~~~l~Dt~G~-~~~~~~~~~~~~~~d~ii~v~D~~~~------------~~~~~~~~~~~~~~~~~~~  100 (162)
T cd04157          45 LSFTAFDMSGQ-GKYRGLWEHYYKNIQGIIFVIDSSDR------------LRLVVVKDELELLLNHPDI  100 (162)
T ss_pred             EEEEEEECCCC-HhhHHHHHHHHccCCEEEEEEeCCcH------------HHHHHHHHHHHHHHcCccc
Confidence            68999999998 67788899999999999999998853            3444455555556555544


No 24 
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=96.63  E-value=0.003  Score=61.61  Aligned_cols=61  Identities=11%  Similarity=0.287  Sum_probs=45.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      .++.+||++|+ ...+..|..+|.+++++|||+|.++-            +++.+....+..++++..+.+.|+
T Consensus        59 ~~~~l~D~~G~-~~~~~~~~~~~~~~d~vi~V~D~s~~------------~~~~~~~~~l~~~~~~~~~~~~p~  119 (174)
T cd04153          59 IRFLMWDIGGQ-ESLRSSWNTYYTNTDAVILVIDSTDR------------ERLPLTKEELYKMLAHEDLRKAVL  119 (174)
T ss_pred             eEEEEEECCCC-HHHHHHHHHHhhcCCEEEEEEECCCH------------HHHHHHHHHHHHHHhchhhcCCCE
Confidence            68999999998 66778899999999999999998852            345555666666666554444443


No 25 
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=96.60  E-value=0.0033  Score=59.66  Aligned_cols=61  Identities=11%  Similarity=0.242  Sum_probs=47.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ..+++||++|+ ...+..|.++|.+++++|||+|.++.            ..+++....|..+..+....+.|+
T Consensus        50 ~~~~l~Dt~G~-~~~~~~~~~~~~~~~~~v~vvd~~~~------------~~~~~~~~~~~~~~~~~~~~~~p~  110 (167)
T cd04160          50 ARLKFWDLGGQ-ESLRSLWDKYYAECHAIIYVIDSTDR------------ERFEESKSALEKVLRNEALEGVPL  110 (167)
T ss_pred             EEEEEEECCCC-hhhHHHHHHHhCCCCEEEEEEECchH------------HHHHHHHHHHHHHHhChhhcCCCE
Confidence            68999999998 66777899999999999999998752            245566667777776655555554


No 26 
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=96.54  E-value=0.0037  Score=61.13  Aligned_cols=61  Identities=15%  Similarity=0.352  Sum_probs=47.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ..+++||++|+ ...+..|.+++.+++++|||+|+++.            +++.+....++.+++...+.+.|+
T Consensus        63 ~~~~l~D~~G~-~~~~~~~~~~~~~ad~iilV~D~~~~------------~s~~~~~~~~~~i~~~~~~~~~pv  123 (190)
T cd00879          63 IKFKTFDLGGH-EQARRLWKDYFPEVDGIVFLVDAADP------------ERFQESKEELDSLLSDEELANVPF  123 (190)
T ss_pred             EEEEEEECCCC-HHHHHHHHHHhccCCEEEEEEECCcH------------HHHHHHHHHHHHHHcCccccCCCE
Confidence            57899999998 56778899999999999999998852            456667777887777655555554


No 27 
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport]
Probab=96.51  E-value=0.0012  Score=66.93  Aligned_cols=61  Identities=15%  Similarity=0.365  Sum_probs=52.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ++|+.+|+||. ..-|+-|..||-.|++|+|.|+..|            .-|+.||++-.+++++..-+++.||
T Consensus        64 m~ftt~DLGGH-~qArr~wkdyf~~v~~iv~lvda~d------------~er~~es~~eld~ll~~e~la~vp~  124 (193)
T KOG0077|consen   64 MTFTTFDLGGH-LQARRVWKDYFPQVDAIVYLVDAYD------------QERFAESKKELDALLSDESLATVPF  124 (193)
T ss_pred             ceEEEEccccH-HHHHHHHHHHHhhhceeEeeeehhh------------HHHhHHHHHHHHHHHhHHHHhcCcc
Confidence            78999999999 7789999999999999999999774            3688888888888888777777765


No 28 
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=96.35  E-value=0.0066  Score=58.90  Aligned_cols=37  Identities=16%  Similarity=0.226  Sum_probs=33.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      .++++||++|+ ...+..|.++|.+++++|||+|.++.
T Consensus        44 ~~l~i~Dt~G~-~~~~~~~~~~~~~ad~ii~V~D~t~~   80 (164)
T cd04162          44 AIMELLEIGGS-QNLRKYWKRYLSGSQGLIFVVDSADS   80 (164)
T ss_pred             eEEEEEECCCC-cchhHHHHHHHhhCCEEEEEEECCCH
Confidence            68999999998 67788999999999999999998863


No 29 
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=96.30  E-value=0.0063  Score=57.82  Aligned_cols=37  Identities=16%  Similarity=0.372  Sum_probs=33.2

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      .++++||++|+ ...+..|..+|.+++++|||+|+++.
T Consensus        43 ~~~~i~Dt~G~-~~~~~~~~~~~~~~~~ii~v~d~~~~   79 (158)
T cd04151          43 LKFQVWDLGGQ-TSIRPYWRCYYSNTDAIIYVVDSTDR   79 (158)
T ss_pred             EEEEEEECCCC-HHHHHHHHHHhcCCCEEEEEEECCCH
Confidence            68999999998 66788899999999999999999864


No 30 
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=96.11  E-value=0.01  Score=56.03  Aligned_cols=61  Identities=16%  Similarity=0.180  Sum_probs=46.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ..+.+||++|+ ...+..|..+|.++++||||+|.++.            +++.+....+..+..++.+.+.|+
T Consensus        44 ~~l~i~D~~G~-~~~~~~~~~~~~~~~~iv~v~D~~~~------------~~~~~~~~~~~~~~~~~~~~~~pi  104 (160)
T cd04156          44 LSLTVWDVGGQ-EKMRTVWKCYLENTDGLVYVVDSSDE------------ARLDESQKELKHILKNEHIKGVPV  104 (160)
T ss_pred             eEEEEEECCCC-HhHHHHHHHHhccCCEEEEEEECCcH------------HHHHHHHHHHHHHHhchhhcCCCE
Confidence            57999999998 66677899999999999999998853            345566666666666655555554


No 31 
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=96.08  E-value=0.0095  Score=57.68  Aligned_cols=36  Identities=22%  Similarity=0.349  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+.+||++|+ ...+..|..+|.+++++|||+|.++
T Consensus        58 ~~l~l~D~~G~-~~~~~~~~~~~~~~d~~i~v~d~~~   93 (173)
T cd04154          58 YKLNIWDVGGQ-KTLRPYWRNYFESTDALIWVVDSSD   93 (173)
T ss_pred             EEEEEEECCCC-HHHHHHHHHHhCCCCEEEEEEECCC
Confidence            57899999998 5567789999999999999999885


No 32 
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=95.92  E-value=0.015  Score=54.82  Aligned_cols=61  Identities=15%  Similarity=0.239  Sum_probs=49.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWNF  818 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~f  818 (819)
                      ..+.+||++|+ ...+..|..++.+++++|||+|.++            ..++.++...|..++.+....+.|+
T Consensus        43 ~~~~i~D~~G~-~~~~~~~~~~~~~~~~~i~v~D~~~------------~~~~~~~~~~~~~~~~~~~~~~~pi  103 (158)
T cd00878          43 VSFTVWDVGGQ-DKIRPLWKHYYENTNGIIFVVDSSD------------RERIEEAKEELHKLLNEEELKGVPL  103 (158)
T ss_pred             EEEEEEECCCC-hhhHHHHHHHhccCCEEEEEEECCC------------HHHHHHHHHHHHHHHhCcccCCCcE
Confidence            68999999998 5567789999999999999999883            3578888888888888655555554


No 33 
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only]
Probab=95.74  E-value=0.0063  Score=60.67  Aligned_cols=34  Identities=29%  Similarity=0.458  Sum_probs=28.1

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHH------HHhcCCCCC
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAK------ILYKAVPFS  561 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMK------ILy~p~GFS  561 (819)
                      +.++++||||||-+.+||+||+||++      ++-. +||+
T Consensus        13 ~t~rEirilllGldnAGKTT~LKqL~sED~~hltpT-~GFn   52 (185)
T KOG0074|consen   13 RTRREIRILLLGLDNAGKTTFLKQLKSEDPRHLTPT-NGFN   52 (185)
T ss_pred             CCcceEEEEEEecCCCcchhHHHHHccCChhhcccc-CCcc
Confidence            34789999999999999999999997      3444 6674


No 34 
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=95.30  E-value=0.032  Score=53.06  Aligned_cols=36  Identities=0%  Similarity=-0.068  Sum_probs=32.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..++.+++++|||+|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~~d~~ilv~d~~~   84 (164)
T cd04175          49 CMLEILDTAGT-EQFTAMRDLYMKNGQGFVLVYSITA   84 (164)
T ss_pred             EEEEEEECCCc-ccchhHHHHHHhhCCEEEEEEECCC
Confidence            67889999998 6788889999999999999999874


No 35 
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=95.27  E-value=0.027  Score=55.62  Aligned_cols=37  Identities=14%  Similarity=0.196  Sum_probs=33.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+ ...+..|..+|.+++++|||+|.++.
T Consensus        52 ~~l~l~Dt~G~-~~~~~~~~~~~~~~d~ii~v~D~~~~   88 (183)
T cd04152          52 ITFHFWDVGGQ-EKLRPLWKSYTRCTDGIVFVVDSVDV   88 (183)
T ss_pred             eEEEEEECCCc-HhHHHHHHHHhccCCEEEEEEECCCH
Confidence            68999999998 56678899999999999999999864


No 36 
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=95.15  E-value=0.043  Score=52.04  Aligned_cols=36  Identities=6%  Similarity=-0.091  Sum_probs=32.3

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..++.+++++|||.|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~ad~~i~v~d~~~   84 (163)
T cd04176          49 SVLEILDTAGT-EQFASMRDLYIKNGQGFIVVYSLVN   84 (163)
T ss_pred             EEEEEEECCCc-ccccchHHHHHhhCCEEEEEEECCC
Confidence            57899999998 6778889999999999999999986


No 37 
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=94.95  E-value=0.043  Score=50.48  Aligned_cols=38  Identities=8%  Similarity=0.253  Sum_probs=33.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD  783 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYD  783 (819)
                      ..+.+||++|+ ...+..|.+++.+++++|||+|+++.+
T Consensus        44 ~~~~~~D~~g~-~~~~~~~~~~~~~~d~ii~v~d~~~~~   81 (159)
T cd04159          44 VTLKVWDLGGQ-PRFRSMWERYCRGVNAIVYVVDAADRT   81 (159)
T ss_pred             EEEEEEECCCC-HhHHHHHHHHHhcCCEEEEEEECCCHH
Confidence            57899999998 667788999999999999999998754


No 38 
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=94.65  E-value=0.065  Score=50.42  Aligned_cols=36  Identities=0%  Similarity=-0.066  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..++.+++++|||+|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~~~~~ilv~d~~~   84 (163)
T cd04136          49 CMLEILDTAGT-EQFTAMRDLYIKNGQGFVLVYSITS   84 (163)
T ss_pred             EEEEEEECCCc-cccchHHHHHhhcCCEEEEEEECCC
Confidence            67889999998 6677788889999999999999986


No 39 
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=94.63  E-value=0.026  Score=55.82  Aligned_cols=26  Identities=31%  Similarity=0.639  Sum_probs=23.6

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHH
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..++.+|||+||..+|||||++++++
T Consensus        10 ~~~~~~~ililGl~~sGKTtll~~l~   35 (175)
T PF00025_consen   10 SKKKEIKILILGLDGSGKTTLLNRLK   35 (175)
T ss_dssp             TTTSEEEEEEEESTTSSHHHHHHHHH
T ss_pred             ccCcEEEEEEECCCccchHHHHHHhh
Confidence            34789999999999999999999986


No 40 
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=94.19  E-value=0.066  Score=54.86  Aligned_cols=37  Identities=11%  Similarity=0.110  Sum_probs=33.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +++++||++|| ...+..|..||.+++++|||+|+++-
T Consensus        49 v~l~iwDtaGq-e~~~~l~~~y~~~ad~iIlVfDvtd~   85 (202)
T cd04120          49 IRLQIWDTAGQ-ERFNSITSAYYRSAKGIILVYDITKK   85 (202)
T ss_pred             EEEEEEeCCCc-hhhHHHHHHHhcCCCEEEEEEECcCH
Confidence            78999999998 67788899999999999999999963


No 41 
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=94.03  E-value=0.035  Score=53.19  Aligned_cols=27  Identities=26%  Similarity=0.464  Sum_probs=22.9

Q ss_pred             HHhcceeeEEEeecCCCCchhHHHHHH
Q 003444          526 IERRTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       526 ~~~k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ....+..|++++|..++|||||++++.
T Consensus         9 ~~~~~~~~v~i~G~~g~GKStLl~~l~   35 (173)
T cd04155           9 RKSSEEPRILILGLDNAGKTTILKQLA   35 (173)
T ss_pred             hccCCccEEEEEccCCCCHHHHHHHHh
Confidence            344558999999999999999999874


No 42 
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=93.87  E-value=0.039  Score=53.79  Aligned_cols=24  Identities=25%  Similarity=0.534  Sum_probs=22.3

Q ss_pred             hcceeeEEEeecCCCCchhHHHHH
Q 003444          528 RRTLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       528 ~k~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      +|+.+|++|||.+++|||||++++
T Consensus         1 ~~~~~kv~~vG~~~vGKTsli~~~   24 (169)
T cd01892           1 QRNVFLCFVLGAKGSGKSALLRAF   24 (169)
T ss_pred             CCeEEEEEEECCCCCcHHHHHHHH
Confidence            578999999999999999999986


No 43 
>PTZ00099 rab6; Provisional
Probab=93.86  E-value=0.1  Score=52.21  Aligned_cols=36  Identities=14%  Similarity=0.121  Sum_probs=32.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+.+||++|+ ...+..|..+|.+++++|||+|+++
T Consensus        29 v~l~iwDt~G~-e~~~~~~~~~~~~ad~~ilv~D~t~   64 (176)
T PTZ00099         29 VRLQLWDTAGQ-ERFRSLIPSYIRDSAAAIVVYDITN   64 (176)
T ss_pred             EEEEEEECCCh-HHhhhccHHHhCCCcEEEEEEECCC
Confidence            78999999998 6677789999999999999999987


No 44 
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=93.84  E-value=0.04  Score=49.76  Aligned_cols=35  Identities=17%  Similarity=0.096  Sum_probs=26.8

Q ss_pred             EEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          747 YQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       747 frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +++||++|+ ......|...+...+++|||.|+++.
T Consensus        52 ~~~~d~~g~-~~~~~~~~~~~~~~d~~ilv~D~s~~   86 (119)
T PF08477_consen   52 LQFWDFGGQ-EEFYSQHQFFLKKADAVILVYDLSDP   86 (119)
T ss_dssp             EEEEEESSS-HCHHCTSHHHHHHSCEEEEEEECCGH
T ss_pred             EEEEecCcc-ceecccccchhhcCcEEEEEEcCCCh
Confidence            778899987 34444466568889999999999864


No 45 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=93.82  E-value=0.045  Score=49.95  Aligned_cols=24  Identities=29%  Similarity=0.385  Sum_probs=20.4

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ++++.|+.+|||||+.|++.=.++
T Consensus         1 vI~I~G~~gsGKST~a~~La~~~~   24 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAKELAERLG   24 (121)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHHT
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHC
Confidence            478999999999999999875443


No 46 
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=93.65  E-value=0.11  Score=54.77  Aligned_cols=56  Identities=7%  Similarity=0.015  Sum_probs=41.2

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLL  813 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F  813 (819)
                      +.+++||++|+ ...+..|..++.+++++|||.|+++            ..-+.+...+++.|...+|+
T Consensus        48 ~~l~I~Dt~G~-~~~~~~~~~~~~~ad~iIlVfdv~~------------~~Sf~~i~~~~~~I~~~k~~  103 (247)
T cd04143          48 YQLDILDTSGN-HPFPAMRRLSILTGDVFILVFSLDN------------RESFEEVCRLREQILETKSC  103 (247)
T ss_pred             EEEEEEECCCC-hhhhHHHHHHhccCCEEEEEEeCCC------------HHHHHHHHHHHHHHHHhhcc
Confidence            67889999998 5555566677889999999999884            23455566677777665443


No 47 
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=93.61  E-value=0.13  Score=53.82  Aligned_cols=37  Identities=11%  Similarity=0.134  Sum_probs=32.3

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+.+||++|| ...+..|-.+|.+++++|||.|+++-
T Consensus        49 v~L~iwDt~G~-e~~~~l~~~~~~~~d~illvfdis~~   85 (222)
T cd04173          49 IELNMWDTSGS-SYYDNVRPLAYPDSDAVLICFDISRP   85 (222)
T ss_pred             EEEEEEeCCCc-HHHHHHhHHhccCCCEEEEEEECCCH
Confidence            78999999998 56667788899999999999999864


No 48 
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=93.48  E-value=0.15  Score=50.88  Aligned_cols=37  Identities=8%  Similarity=0.151  Sum_probs=32.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|| ...+.-|..+|.+++++|+|.|+++-
T Consensus        51 ~~l~i~Dt~G~-e~~~~l~~~~~~~a~~~ilvydit~~   87 (191)
T cd01875          51 VSLNLWDTAGQ-EEYDRLRTLSYPQTNVFIICFSIASP   87 (191)
T ss_pred             EEEEEEECCCc-hhhhhhhhhhccCCCEEEEEEECCCH
Confidence            78999999998 66777888899999999999999863


No 49 
>PRK08118 topology modulation protein; Reviewed
Probab=93.30  E-value=0.052  Score=54.04  Aligned_cols=23  Identities=39%  Similarity=0.631  Sum_probs=20.1

Q ss_pred             eeEEEeecCCCCchhHHHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .|++++|++||||||+.|++--.
T Consensus         2 ~rI~I~G~~GsGKSTlak~L~~~   24 (167)
T PRK08118          2 KKIILIGSGGSGKSTLARQLGEK   24 (167)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHH
Confidence            37999999999999999988643


No 50 
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=93.14  E-value=0.06  Score=52.72  Aligned_cols=24  Identities=25%  Similarity=0.492  Sum_probs=21.4

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .+..||+++|.++|||||+++++.
T Consensus        17 ~~~~ki~ilG~~~~GKStLi~~l~   40 (190)
T cd00879          17 NKEAKILFLGLDNAGKTTLLHMLK   40 (190)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHh
Confidence            457999999999999999999864


No 51 
>PRK07261 topology modulation protein; Provisional
Probab=93.13  E-value=0.057  Score=53.79  Aligned_cols=24  Identities=38%  Similarity=0.636  Sum_probs=20.4

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHh
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .|++++|++||||||+.+++--.+
T Consensus         1 ~ri~i~G~~GsGKSTla~~l~~~~   24 (171)
T PRK07261          1 MKIAIIGYSGSGKSTLARKLSQHY   24 (171)
T ss_pred             CEEEEEcCCCCCHHHHHHHHHHHh
Confidence            379999999999999999985433


No 52 
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=93.08  E-value=0.059  Score=51.02  Aligned_cols=21  Identities=29%  Similarity=0.629  Sum_probs=19.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|.+++|||||+.++.
T Consensus         1 ~ki~v~G~~~vGKTsli~~l~   21 (161)
T cd04113           1 FKFIIIGSSGTGKSCLLHRFV   21 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999999864


No 53 
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=93.01  E-value=0.2  Score=49.06  Aligned_cols=36  Identities=8%  Similarity=0.084  Sum_probs=32.3

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|.++|.+++++|||.|+++
T Consensus        50 ~~l~i~Dt~G~-~~~~~l~~~~~~~~d~~ilv~d~~~   85 (172)
T cd04141          50 ALLDILDTAGQ-AEFTAMRDQYMRCGEGFIICYSVTD   85 (172)
T ss_pred             EEEEEEeCCCc-hhhHHHhHHHhhcCCEEEEEEECCc
Confidence            67899999998 6778889999999999999999885


No 54 
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=93.01  E-value=0.065  Score=48.48  Aligned_cols=22  Identities=27%  Similarity=0.421  Sum_probs=19.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .+|++|+|..+|||||++.++.
T Consensus         1 ~~ki~~~G~~~~GKstl~~~l~   22 (161)
T TIGR00231         1 EIKIVIVGDPNVGKSTLLNRLL   22 (161)
T ss_pred             CeEEEEECCCCCCHHHHHHHHh
Confidence            3699999999999999998774


No 55 
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=92.97  E-value=0.063  Score=49.20  Aligned_cols=21  Identities=29%  Similarity=0.531  Sum_probs=19.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+++|..+||||||++++.
T Consensus         1 ~~i~~~G~~~~GKStl~~~l~   21 (159)
T cd00154           1 FKIVLIGDSGVGKTSLLLRFV   21 (159)
T ss_pred             CeEEEECCCCCCHHHHHHHHH
Confidence            589999999999999999864


No 56 
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=92.88  E-value=0.067  Score=51.84  Aligned_cols=26  Identities=23%  Similarity=0.457  Sum_probs=22.0

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHH
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .....+||+++|.+++||||+++++.
T Consensus        10 ~~~~~~kv~ivG~~~~GKTsL~~~l~   35 (173)
T cd04154          10 LKEREMRILILGLDNAGKTTILKKLL   35 (173)
T ss_pred             cCCCccEEEEECCCCCCHHHHHHHHc
Confidence            33456899999999999999999863


No 57 
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=92.83  E-value=0.07  Score=49.78  Aligned_cols=22  Identities=36%  Similarity=0.459  Sum_probs=19.7

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.|++++|..++|||||++++.
T Consensus         1 ~~ki~iiG~~~vGKTsl~~~~~   22 (162)
T cd04138           1 EYKLVVVGAGGVGKSALTIQLI   22 (162)
T ss_pred             CeEEEEECCCCCCHHHHHHHHH
Confidence            3699999999999999998874


No 58 
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism]
Probab=92.79  E-value=0.067  Score=54.26  Aligned_cols=21  Identities=33%  Similarity=0.630  Sum_probs=18.5

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .||++||++||||||+.|++-
T Consensus         1 ~riiilG~pGaGK~T~A~~La   21 (178)
T COG0563           1 MRILILGPPGAGKSTLAKKLA   21 (178)
T ss_pred             CeEEEECCCCCCHHHHHHHHH
Confidence            379999999999999988763


No 59 
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=92.76  E-value=0.2  Score=48.05  Aligned_cols=36  Identities=14%  Similarity=0.384  Sum_probs=31.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+.+||++|+ ...+..|..++++++++|||+|.++
T Consensus        58 ~~~~~~D~~G~-~~~~~~~~~~~~~~~~ii~v~D~~~   93 (173)
T cd04155          58 FKLNVWDIGGQ-RAIRPYWRNYFENTDCLIYVIDSAD   93 (173)
T ss_pred             EEEEEEECCCC-HHHHHHHHHHhcCCCEEEEEEeCCC
Confidence            57899999998 5566779999999999999999986


No 60 
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=92.76  E-value=0.07  Score=50.63  Aligned_cols=20  Identities=20%  Similarity=0.381  Sum_probs=18.8

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +|++++|..++||||+++|+
T Consensus         1 iki~i~G~~~~GKSsli~~l   20 (171)
T cd00157           1 IKIVVVGDGAVGKTCLLISY   20 (171)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            59999999999999999986


No 61 
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=92.72  E-value=0.17  Score=49.76  Aligned_cols=36  Identities=6%  Similarity=0.125  Sum_probs=31.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +++++||++|+ ...+..|..+|.+++++|||.|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~a~~~ilv~d~~~   84 (175)
T cd01874          49 YTLGLFDTAGQ-EDYDRLRPLSYPQTDVFLVCFSVVS   84 (175)
T ss_pred             EEEEEEECCCc-cchhhhhhhhcccCCEEEEEEECCC
Confidence            67899999998 5666778889999999999999875


No 62 
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=92.54  E-value=0.079  Score=52.58  Aligned_cols=24  Identities=29%  Similarity=0.549  Sum_probs=21.8

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ++.+|++|+|.+++||||+++++.
T Consensus        15 ~~~~kv~lvG~~~vGKTsli~~~~   38 (182)
T PTZ00133         15 KKEVRILMVGLDAAGKTTILYKLK   38 (182)
T ss_pred             CCccEEEEEcCCCCCHHHHHHHHh
Confidence            557899999999999999999984


No 63 
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=92.25  E-value=0.089  Score=49.44  Aligned_cols=20  Identities=35%  Similarity=0.650  Sum_probs=18.7

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +||+++|..+|||||+++++
T Consensus         1 ~kv~v~G~~~~GKTtli~~l   20 (164)
T smart00175        1 FKIILIGDSGVGKSSLLSRF   20 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            59999999999999999976


No 64 
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=92.24  E-value=0.3  Score=47.36  Aligned_cols=36  Identities=14%  Similarity=0.239  Sum_probs=31.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      .++++||++|+ ...+..|..++.+++++|||.|+++
T Consensus        48 ~~~~i~Dt~G~-~~~~~~~~~~~~~a~~~i~v~d~~~   83 (173)
T cd04130          48 VRLQLCDTAGQ-DEFDKLRPLCYPDTDVFLLCFSVVN   83 (173)
T ss_pred             EEEEEEECCCC-hhhccccccccCCCcEEEEEEECCC
Confidence            67899999998 5667778889999999999999886


No 65 
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=92.13  E-value=0.23  Score=46.88  Aligned_cols=37  Identities=3%  Similarity=0.065  Sum_probs=32.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||.+|+ ...+..|.+++.+++++|||+|+++.
T Consensus        50 ~~~~i~D~~G~-~~~~~~~~~~~~~~~~~i~v~d~~~~   86 (163)
T cd01860          50 VKFEIWDTAGQ-ERYRSLAPMYYRGAAAAIVVYDITSE   86 (163)
T ss_pred             EEEEEEeCCch-HHHHHHHHHHhccCCEEEEEEECcCH
Confidence            68999999998 56777898899999999999999853


No 66 
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=92.02  E-value=0.11  Score=49.64  Aligned_cols=21  Identities=48%  Similarity=0.654  Sum_probs=19.2

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..|++++|.+++|||||+.++
T Consensus         2 ~~ki~i~G~~~vGKSsli~~~   22 (166)
T cd01869           2 LFKLLLIGDSGVGKSCLLLRF   22 (166)
T ss_pred             eEEEEEECCCCCCHHHHHHHH
Confidence            479999999999999999876


No 67 
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=92.02  E-value=0.097  Score=50.45  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|.+++||||+++++.
T Consensus         1 ~kv~~~G~~~~GKTsli~~l~   21 (159)
T cd04150           1 MRILMVGLDAAGKTTILYKLK   21 (159)
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            589999999999999999863


No 68 
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=91.96  E-value=0.21  Score=49.59  Aligned_cols=37  Identities=3%  Similarity=-0.027  Sum_probs=31.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+ ...+..|..+|.+++++|||+|+++.
T Consensus        47 ~~l~i~Dt~G~-~~~~~~~~~~~~~ad~~ilv~d~~~~   83 (190)
T cd04144          47 CMLEVLDTAGQ-EEYTALRDQWIREGEGFILVYSITSR   83 (190)
T ss_pred             EEEEEEECCCc-hhhHHHHHHHHHhCCEEEEEEECCCH
Confidence            57899999998 56677788899999999999999853


No 69 
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=91.84  E-value=0.11  Score=49.05  Aligned_cols=22  Identities=32%  Similarity=0.369  Sum_probs=19.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ++|++++|.+++|||||++++.
T Consensus         1 ~~ki~v~G~~~~GKSsli~~l~   22 (163)
T cd01860           1 QFKLVLLGDSSVGKSSLVLRFV   22 (163)
T ss_pred             CeEEEEECCCCCCHHHHHHHHH
Confidence            4799999999999999998763


No 70 
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=91.82  E-value=0.11  Score=48.53  Aligned_cols=19  Identities=42%  Similarity=0.655  Sum_probs=17.6

Q ss_pred             EEEeecCCCCchhHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMK  552 (819)
                      ++|.|..+|||||+.|++.
T Consensus         2 ii~~G~pgsGKSt~a~~l~   20 (143)
T PF13671_consen    2 IILCGPPGSGKSTLAKRLA   20 (143)
T ss_dssp             EEEEESTTSSHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            6899999999999999976


No 71 
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=91.78  E-value=0.12  Score=48.90  Aligned_cols=19  Identities=32%  Similarity=0.681  Sum_probs=17.9

Q ss_pred             eEEEeecCCCCchhHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQM  551 (819)
                      ||+++|.+++||||+++++
T Consensus         1 Ki~vvG~~~vGKtsl~~~~   19 (162)
T PF00071_consen    1 KIVVVGDSGVGKTSLINRL   19 (162)
T ss_dssp             EEEEEESTTSSHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHH
Confidence            8999999999999999975


No 72 
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=91.77  E-value=0.11  Score=49.23  Aligned_cols=21  Identities=33%  Similarity=0.482  Sum_probs=18.9

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .|++++|.+++||||+++++.
T Consensus         1 ~ki~v~G~~~~GKTsli~~~~   21 (164)
T smart00173        1 YKLVVLGSGGVGKSALTIQFV   21 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            489999999999999999763


No 73 
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=91.76  E-value=0.14  Score=52.05  Aligned_cols=37  Identities=19%  Similarity=0.345  Sum_probs=32.6

Q ss_pred             ccEEEEEecccccccccccccccCCC-CEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDI-GMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdV-taVIFvVSLSdY  782 (819)
                      ..|++||++|+ ..-|.+|..++.++ ++||||+|.+++
T Consensus        48 ~~~~l~D~pG~-~~~~~~~~~~~~~~~~~vV~VvD~~~~   85 (203)
T cd04105          48 KKFRLVDVPGH-PKLRDKLLETLKNSAKGIVFVVDSATF   85 (203)
T ss_pred             ceEEEEECCCC-HHHHHHHHHHHhccCCEEEEEEECccc
Confidence            46899999998 56788999999998 999999999974


No 74 
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=91.72  E-value=0.12  Score=47.02  Aligned_cols=20  Identities=20%  Similarity=0.469  Sum_probs=18.2

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      |++|+|..++|||||++.+-
T Consensus         1 ~V~iiG~~~~GKSTlin~l~   20 (116)
T PF01926_consen    1 RVAIIGRPNVGKSTLINALT   20 (116)
T ss_dssp             EEEEEESTTSSHHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHHh
Confidence            68999999999999999873


No 75 
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=91.69  E-value=0.11  Score=48.38  Aligned_cols=21  Identities=19%  Similarity=0.321  Sum_probs=19.0

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+++|..++||||+++++.
T Consensus         1 ~ki~i~G~~~~GKStli~~l~   21 (162)
T cd04123           1 FKVVLLGEGRVGKTSLVLRYV   21 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            599999999999999998764


No 76 
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=91.68  E-value=0.11  Score=48.62  Aligned_cols=21  Identities=33%  Similarity=0.499  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .||.++|.+++||||+++++.
T Consensus         1 ~ki~~~G~~~~GKTsl~~~l~   21 (164)
T cd04139           1 YKVIVVGAGGVGKSALTLQFM   21 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            489999999999999998875


No 77 
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=91.68  E-value=0.14  Score=44.22  Aligned_cols=23  Identities=30%  Similarity=0.508  Sum_probs=20.4

Q ss_pred             EEEeecCCCCchhHHHHHHHHhc
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .|+.|..|||||||+.-++.+--
T Consensus        26 tli~G~nGsGKSTllDAi~~~L~   48 (62)
T PF13555_consen   26 TLITGPNGSGKSTLLDAIQTVLY   48 (62)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHc
Confidence            78999999999999999986654


No 78 
>COG4639 Predicted kinase [General function prediction only]
Probab=91.65  E-value=0.32  Score=49.49  Aligned_cols=17  Identities=53%  Similarity=0.759  Sum_probs=15.8

Q ss_pred             EEEeecCCCCchhHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQ  550 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQ  550 (819)
                      ++|.|+.+|||||+.|+
T Consensus         5 vvL~G~~~sGKsT~ak~   21 (168)
T COG4639           5 VVLRGASGSGKSTFAKE   21 (168)
T ss_pred             EEEecCCCCchhHHHHH
Confidence            57889999999999998


No 79 
>PRK06217 hypothetical protein; Validated
Probab=91.62  E-value=0.12  Score=51.65  Aligned_cols=25  Identities=28%  Similarity=0.369  Sum_probs=21.2

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .||+|.|.+||||||+.+++.-.++
T Consensus         2 ~~I~i~G~~GsGKSTla~~L~~~l~   26 (183)
T PRK06217          2 MRIHITGASGSGTTTLGAALAERLD   26 (183)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHcC
Confidence            4799999999999999998864443


No 80 
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=91.59  E-value=0.12  Score=49.85  Aligned_cols=23  Identities=17%  Similarity=0.310  Sum_probs=20.7

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.+|++++|.+++||||++.++.
T Consensus         1 r~~ki~vvG~~~vGKTsli~~~~   23 (170)
T cd04115           1 RIFKIIVIGDSNVGKTCLTYRFC   23 (170)
T ss_pred             CceEEEEECCCCCCHHHHHHHHH
Confidence            46899999999999999999873


No 81 
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=91.58  E-value=0.16  Score=51.45  Aligned_cols=36  Identities=8%  Similarity=0.054  Sum_probs=32.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|| ...+..|..+|.+++++|||.|+++
T Consensus        55 ~~l~iwDt~G~-~~~~~l~~~~~~~ad~illVfD~t~   90 (189)
T cd04121          55 VKLQLWDTSGQ-GRFCTIFRSYSRGAQGIILVYDITN   90 (189)
T ss_pred             EEEEEEeCCCc-HHHHHHHHHHhcCCCEEEEEEECcC
Confidence            78999999998 6677889899999999999999985


No 82 
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=91.52  E-value=0.13  Score=49.06  Aligned_cols=24  Identities=25%  Similarity=0.527  Sum_probs=21.3

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +...|++++|..++||||+++++.
T Consensus         5 ~~~~~v~v~G~~~~GKSsli~~l~   28 (169)
T cd04114           5 DFLFKIVLIGNAGVGKTCLVRRFT   28 (169)
T ss_pred             CceeEEEEECCCCCCHHHHHHHHH
Confidence            456899999999999999999863


No 83 
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=91.48  E-value=0.12  Score=49.12  Aligned_cols=24  Identities=29%  Similarity=0.636  Sum_probs=20.5

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +|+++|..++||||+++|+.-.+.
T Consensus         1 ~i~~vG~~~~GKstLi~~l~~~~~   24 (167)
T cd04160           1 SVLILGLDNAGKTTFLEQLKTLFS   24 (167)
T ss_pred             CEEEEecCCCCHHHHHHHHhhhcc
Confidence            589999999999999999865443


No 84 
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=91.39  E-value=0.13  Score=51.34  Aligned_cols=22  Identities=23%  Similarity=0.460  Sum_probs=20.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..||+++|.+++||||++.++.
T Consensus         5 ~~kivv~G~~g~GKTtl~~~l~   26 (219)
T COG1100           5 EFKIVVLGDGGVGKTTLLNRLV   26 (219)
T ss_pred             eEEEEEEcCCCccHHHHHHHHh
Confidence            3899999999999999999875


No 85 
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=91.39  E-value=0.19  Score=48.56  Aligned_cols=36  Identities=14%  Similarity=0.121  Sum_probs=31.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|| ...+..|..++.+++++|||.|+++
T Consensus        63 ~~~~i~Dt~G~-~~~~~~~~~~~~~~~~~i~v~d~~~   98 (180)
T cd04127          63 IHLQLWDTAGQ-ERFRSLTTAFFRDAMGFLLIFDLTN   98 (180)
T ss_pred             EEEEEEeCCCh-HHHHHHHHHHhCCCCEEEEEEECCC
Confidence            67899999998 5667778889999999999999885


No 86 
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=91.35  E-value=0.13  Score=49.22  Aligned_cols=21  Identities=19%  Similarity=0.305  Sum_probs=18.6

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|.+++||||++.++.
T Consensus         1 ~ki~i~G~~~~GKTsl~~~~~   21 (174)
T cd04135           1 LKCVVVGDGAVGKTCLLMSYA   21 (174)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999996653


No 87 
>PLN00223 ADP-ribosylation factor; Provisional
Probab=91.27  E-value=0.13  Score=51.06  Aligned_cols=24  Identities=29%  Similarity=0.556  Sum_probs=21.4

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ++.+||+++|..+||||||++++.
T Consensus        15 ~~~~ki~ivG~~~~GKTsl~~~l~   38 (181)
T PLN00223         15 KKEMRILMVGLDAAGKTTILYKLK   38 (181)
T ss_pred             CCccEEEEECCCCCCHHHHHHHHc
Confidence            456899999999999999999874


No 88 
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=91.25  E-value=0.14  Score=48.31  Aligned_cols=21  Identities=24%  Similarity=0.455  Sum_probs=19.0

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+++|..++||||++.++.
T Consensus         1 ~kv~~vG~~~~GKTsl~~~~~   21 (162)
T cd04106           1 IKVIVVGNGNVGKSSMIQRFV   21 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            589999999999999999753


No 89 
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=91.23  E-value=0.16  Score=51.87  Aligned_cols=24  Identities=29%  Similarity=0.545  Sum_probs=21.1

Q ss_pred             hcceeeEEEeecCCCCchhHHHHH
Q 003444          528 RRTLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       528 ~k~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..+++++|+||..+||||||+|-+
T Consensus        13 kerE~riLiLGLdNsGKTti~~kl   36 (185)
T KOG0073|consen   13 KEREVRILILGLDNSGKTTIVKKL   36 (185)
T ss_pred             hhheeEEEEEecCCCCchhHHHHh
Confidence            445999999999999999999854


No 90 
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=91.23  E-value=0.35  Score=47.63  Aligned_cols=37  Identities=8%  Similarity=0.118  Sum_probs=32.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +++++||++|+ ...+..|..+|.+++++|||.|+++-
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~~d~~ilv~d~~~~   85 (174)
T cd01871          49 VNLGLWDTAGQ-EDYDRLRPLSYPQTDVFLICFSLVSP   85 (174)
T ss_pred             EEEEEEECCCc-hhhhhhhhhhcCCCCEEEEEEECCCH
Confidence            68899999998 66677888899999999999999863


No 91 
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=91.21  E-value=0.44  Score=44.44  Aligned_cols=36  Identities=3%  Similarity=-0.035  Sum_probs=31.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||.+|+ ...+..|.+++.+++++|+|+++++
T Consensus        49 ~~~~i~Dt~G~-~~~~~l~~~~~~~~~~~i~v~~~~~   84 (162)
T cd04138          49 CLLDILDTAGQ-EEYSAMRDQYMRTGEGFLCVFAINS   84 (162)
T ss_pred             EEEEEEECCCC-cchHHHHHHHHhcCCEEEEEEECCC
Confidence            56889999998 5667788889999999999999985


No 92 
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=91.20  E-value=0.14  Score=48.17  Aligned_cols=21  Identities=24%  Similarity=0.471  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .|++|+|..+|||||+++++.
T Consensus         1 ~ki~liG~~~~GKSsli~~l~   21 (161)
T cd01861           1 HKLVFLGDQSVGKTSIITRFM   21 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            489999999999999999874


No 93 
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=91.15  E-value=0.15  Score=50.62  Aligned_cols=24  Identities=25%  Similarity=0.505  Sum_probs=21.7

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ++..||+++|..++||||+++++.
T Consensus        15 ~~~~~i~ivG~~~~GKTsli~~l~   38 (184)
T smart00178       15 NKHAKILFLGLDNAGKTTLLHMLK   38 (184)
T ss_pred             cccCEEEEECCCCCCHHHHHHHHh
Confidence            567999999999999999999874


No 94 
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=91.05  E-value=0.24  Score=49.64  Aligned_cols=36  Identities=8%  Similarity=0.053  Sum_probs=31.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+.+||++|+ ...+..|.++|.+++++|||+|+++
T Consensus        55 ~~l~l~D~~G~-~~~~~~~~~~~~~a~~iilv~D~~~   90 (199)
T cd04110          55 VKLQIWDTAGQ-ERFRTITSTYYRGTHGVIVVYDVTN   90 (199)
T ss_pred             EEEEEEeCCCc-hhHHHHHHHHhCCCcEEEEEEECCC
Confidence            57889999998 5677889999999999999999985


No 95 
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=90.93  E-value=0.15  Score=49.98  Aligned_cols=24  Identities=29%  Similarity=0.523  Sum_probs=21.2

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +..+||+|+|.+++|||||++++.
T Consensus        11 ~~~~ki~l~G~~~~GKTsL~~~~~   34 (175)
T smart00177       11 NKEMRILMVGLDAAGKTTILYKLK   34 (175)
T ss_pred             CCccEEEEEcCCCCCHHHHHHHHh
Confidence            347999999999999999998873


No 96 
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=90.92  E-value=0.15  Score=48.94  Aligned_cols=21  Identities=29%  Similarity=0.452  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++|+|..++|||||++++.
T Consensus         1 ~ki~vvG~~~vGKTsli~~~~   21 (161)
T cd04124           1 VKIILLGDSAVGKSKLVERFL   21 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999998764


No 97 
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=90.89  E-value=0.14  Score=47.61  Aligned_cols=20  Identities=35%  Similarity=0.524  Sum_probs=18.5

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      ||+++|..+|||||++.++.
T Consensus         1 ki~i~G~~~~GKTsli~~l~   20 (160)
T cd00876           1 KVVVLGAGGVGKSAITIQFV   20 (160)
T ss_pred             CEEEECCCCCCHHHHHHHHH
Confidence            79999999999999999874


No 98 
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=90.85  E-value=0.16  Score=49.66  Aligned_cols=23  Identities=30%  Similarity=0.430  Sum_probs=20.7

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ...|++++|.+++||||+++++.
T Consensus        14 ~~~kv~~~G~~~~GKTsl~~~l~   36 (174)
T cd04153          14 KEYKVIIVGLDNAGKTTILYQFL   36 (174)
T ss_pred             CccEEEEECCCCCCHHHHHHHHc
Confidence            46899999999999999998874


No 99 
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=90.84  E-value=0.45  Score=45.06  Aligned_cols=36  Identities=3%  Similarity=0.001  Sum_probs=31.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..++.+++++|||.++++
T Consensus        48 ~~l~i~Dt~g~-~~~~~~~~~~~~~~~~~i~v~d~~~   83 (164)
T smart00173       48 CLLDILDTAGQ-EEFSAMRDQYMRTGEGFLLVYSITD   83 (164)
T ss_pred             EEEEEEECCCc-ccchHHHHHHHhhCCEEEEEEECCC
Confidence            68899999998 5666778889999999999999875


No 100
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=90.83  E-value=0.16  Score=48.73  Aligned_cols=20  Identities=30%  Similarity=0.494  Sum_probs=18.6

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +|++++|..++|||||+.++
T Consensus         2 ~ki~i~G~~~~GKSsli~~l   21 (165)
T cd01865           2 FKLLIIGNSSVGKTSFLFRY   21 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHH
Confidence            69999999999999999965


No 101
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=90.74  E-value=0.45  Score=47.61  Aligned_cols=36  Identities=8%  Similarity=0.066  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +++++||.+|+ ...+..|..+|.+++++|+|.|+++
T Consensus        49 v~l~i~Dt~G~-~~~~~~~~~~~~~a~~~ilvyd~~~   84 (176)
T cd04133          49 VNLGLWDTAGQ-EDYNRLRPLSYRGADVFVLAFSLIS   84 (176)
T ss_pred             EEEEEEECCCC-ccccccchhhcCCCcEEEEEEEcCC
Confidence            78999999998 6677778889999999999999884


No 102
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=90.69  E-value=0.34  Score=48.27  Aligned_cols=38  Identities=8%  Similarity=0.087  Sum_probs=33.2

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD  783 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYD  783 (819)
                      +.+++||++|+ ...+..|..++.++++||||+|+++.+
T Consensus        49 ~~l~iwDt~G~-~~~~~~~~~~~~~a~~iilv~D~t~~~   86 (182)
T cd04128          49 ITFSIWDLGGQ-REFINMLPLVCNDAVAILFMFDLTRKS   86 (182)
T ss_pred             EEEEEEeCCCc-hhHHHhhHHHCcCCCEEEEEEECcCHH
Confidence            78999999998 566778888999999999999998643


No 103
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=90.69  E-value=0.18  Score=45.66  Aligned_cols=19  Identities=37%  Similarity=0.538  Sum_probs=17.2

Q ss_pred             EEEeecCCCCchhHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMK  552 (819)
                      |+|-|..+||||||.|.+.
T Consensus         1 I~i~G~~GsGKtTia~~L~   19 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAKELA   19 (129)
T ss_dssp             EEEEESTTSSHHHHHHHHH
T ss_pred             CEEECCCCCCHHHHHHHHH
Confidence            6899999999999999875


No 104
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=90.68  E-value=0.17  Score=47.63  Aligned_cols=21  Identities=29%  Similarity=0.453  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .|++++|..++|||||+.++.
T Consensus         2 ~ki~i~G~~~vGKTsl~~~~~   22 (163)
T cd04136           2 YKVVVLGSGGVGKSALTVQFV   22 (163)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            699999999999999988764


No 105
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=90.63  E-value=0.19  Score=48.02  Aligned_cols=21  Identities=29%  Similarity=0.539  Sum_probs=19.6

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..|++++|..++||||++.++
T Consensus         3 ~~kv~vvG~~~~GKTsli~~l   23 (165)
T cd01864           3 LFKIILIGDSNVGKTCVVQRF   23 (165)
T ss_pred             eeEEEEECCCCCCHHHHHHHH
Confidence            579999999999999999985


No 106
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=90.61  E-value=0.18  Score=49.42  Aligned_cols=23  Identities=26%  Similarity=0.408  Sum_probs=20.4

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.+|++++|..++|||||++|+.
T Consensus         1 ~~~ki~vvG~~~vGKTsL~~~~~   23 (172)
T cd04141           1 REYKIVMLGAGGVGKSAVTMQFI   23 (172)
T ss_pred             CceEEEEECCCCCcHHHHHHHHH
Confidence            35799999999999999998864


No 107
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=90.57  E-value=0.17  Score=48.63  Aligned_cols=21  Identities=33%  Similarity=0.563  Sum_probs=18.7

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|.+++||||++.++.
T Consensus         1 ~ki~vvG~~~~GKTsli~~~~   21 (161)
T cd04117           1 FRLLLIGDSGVGKTCLLCRFT   21 (161)
T ss_pred             CEEEEECcCCCCHHHHHHHHh
Confidence            489999999999999997763


No 108
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=90.57  E-value=0.18  Score=47.35  Aligned_cols=21  Identities=38%  Similarity=0.495  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+++|.+++||||++.++.
T Consensus         1 ~ki~~vG~~~vGKTsli~~l~   21 (168)
T cd04119           1 IKVISMGNSGVGKSCIIKRYC   21 (168)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            599999999999999999764


No 109
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=90.53  E-value=0.18  Score=47.95  Aligned_cols=21  Identities=38%  Similarity=0.651  Sum_probs=19.7

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..|++++|.+++|||||++++
T Consensus         3 ~~ki~vvG~~~~GKSsli~~l   23 (165)
T cd01868           3 LFKIVLIGDSGVGKSNLLSRF   23 (165)
T ss_pred             ceEEEEECCCCCCHHHHHHHH
Confidence            479999999999999999988


No 110
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=90.50  E-value=0.19  Score=48.13  Aligned_cols=23  Identities=30%  Similarity=0.582  Sum_probs=20.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..+|++++|..++|||||++++.
T Consensus         4 ~~~ki~vvG~~~~GKTsli~~~~   26 (170)
T cd04116           4 SLLKVILLGDGGVGKSSLMNRYV   26 (170)
T ss_pred             eEEEEEEECCCCCCHHHHHHHHH
Confidence            46899999999999999999873


No 111
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=90.39  E-value=0.18  Score=48.51  Aligned_cols=22  Identities=27%  Similarity=0.394  Sum_probs=19.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ++|++|+|.+++|||||++++.
T Consensus         1 ~~ki~liG~~~~GKTsli~~~~   22 (168)
T cd04177           1 DYKIVVLGAGGVGKSALTVQFV   22 (168)
T ss_pred             CeEEEEECCCCCCHHHHHHHHH
Confidence            4699999999999999999874


No 112
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=90.38  E-value=0.38  Score=46.20  Aligned_cols=37  Identities=3%  Similarity=0.012  Sum_probs=32.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+ ...+..|..++.+++++|||+|+++-
T Consensus        49 ~~~~i~Dt~G~-~~~~~~~~~~~~~~d~~i~v~d~~~~   85 (161)
T cd04124          49 ILVDFWDTAGQ-ERFQTMHASYYHKAHACILVFDVTRK   85 (161)
T ss_pred             EEEEEEeCCCc-hhhhhhhHHHhCCCCEEEEEEECCCH
Confidence            68899999998 56677899999999999999998753


No 113
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=90.33  E-value=0.18  Score=49.27  Aligned_cols=24  Identities=25%  Similarity=0.501  Sum_probs=21.1

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ++.+|++++|..++|||||++++.
T Consensus         7 ~~~~kv~i~G~~~~GKTsli~~l~   30 (168)
T cd04149           7 NKEMRILMLGLDAAGKTTILYKLK   30 (168)
T ss_pred             CCccEEEEECcCCCCHHHHHHHHc
Confidence            356899999999999999999774


No 114
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=90.28  E-value=0.32  Score=46.59  Aligned_cols=36  Identities=3%  Similarity=0.051  Sum_probs=32.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      .++++||++|+ ...+..|..+|.+++++|||+|+++
T Consensus        51 ~~l~i~Dt~G~-~~~~~~~~~~~~~~~~~ilv~d~~~   86 (166)
T cd04122          51 IKLQIWDTAGQ-ERFRAVTRSYYRGAAGALMVYDITR   86 (166)
T ss_pred             EEEEEEECCCc-HHHHHHHHHHhcCCCEEEEEEECCC
Confidence            68899999998 5667778899999999999999985


No 115
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=90.26  E-value=0.2  Score=48.36  Aligned_cols=22  Identities=36%  Similarity=0.490  Sum_probs=20.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..+|++++|..++||||+++++
T Consensus         3 ~~~ki~ivG~~~vGKTsli~~~   24 (180)
T cd04127           3 YLIKFLALGDSGVGKTSFLYQY   24 (180)
T ss_pred             ceEEEEEECCCCCCHHHHHHHH
Confidence            4689999999999999999886


No 116
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=90.25  E-value=0.19  Score=46.98  Aligned_cols=21  Identities=14%  Similarity=0.365  Sum_probs=19.5

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      .+||+++|..++||||++.++
T Consensus         2 ~~~i~i~G~~~~GKstli~~l   22 (174)
T cd01895           2 PIRIAIIGRPNVGKSSLVNAL   22 (174)
T ss_pred             CcEEEEEcCCCCCHHHHHHHH
Confidence            578999999999999999987


No 117
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=90.19  E-value=0.36  Score=48.33  Aligned_cols=36  Identities=8%  Similarity=0.089  Sum_probs=30.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+..|..++.++++||||+|+++
T Consensus        47 ~~l~i~D~~G~-~~~~~~~~~~~~~ad~vilv~d~~~   82 (198)
T cd04147          47 LTLDILDTSGS-YSFPAMRKLSIQNSDAFALVYAVDD   82 (198)
T ss_pred             EEEEEEECCCc-hhhhHHHHHHhhcCCEEEEEEECCC
Confidence            56789999997 5555667778999999999999986


No 118
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=90.18  E-value=0.19  Score=47.74  Aligned_cols=20  Identities=30%  Similarity=0.624  Sum_probs=18.4

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +||+++|.+++||||++..+
T Consensus         1 ~ki~viG~~~~GKSsl~~~l   20 (172)
T cd01862           1 LKVIILGDSGVGKTSLMNQY   20 (172)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            58999999999999999875


No 119
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=90.16  E-value=0.36  Score=48.31  Aligned_cols=36  Identities=11%  Similarity=0.034  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+..|..+|.+++++|||+|+++
T Consensus        50 ~~l~l~Dt~G~-~~~~~~~~~~~~~a~~~ilv~D~t~   85 (201)
T cd04107          50 VRLQLWDIAGQ-ERFGGMTRVYYRGAVGAIIVFDVTR   85 (201)
T ss_pred             EEEEEEECCCc-hhhhhhHHHHhCCCCEEEEEEECCC
Confidence            67899999998 5677789999999999999999875


No 120
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=90.06  E-value=0.19  Score=50.25  Aligned_cols=21  Identities=33%  Similarity=0.551  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|..++|||||++++.
T Consensus         1 ~KivivG~~~vGKTsli~~l~   21 (201)
T cd04107           1 LKVLVIGDLGVGKTSIIKRYV   21 (201)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999999864


No 121
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=90.05  E-value=0.5  Score=46.11  Aligned_cols=37  Identities=11%  Similarity=-0.179  Sum_probs=31.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      ..+.+||++|+ ...+..|..+|.+++++|||+|.++-
T Consensus        54 ~~l~~~d~~g~-~~~~~~~~~~~~~~d~~llv~d~~~~   90 (169)
T cd01892          54 KYLILREVGED-EVAILLNDAELAACDVACLVYDSSDP   90 (169)
T ss_pred             EEEEEEecCCc-ccccccchhhhhcCCEEEEEEeCCCH
Confidence            57889999998 56677788899999999999998763


No 122
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=90.05  E-value=0.19  Score=47.82  Aligned_cols=20  Identities=25%  Similarity=0.627  Sum_probs=18.8

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      ||+|+|.+++||||+++++.
T Consensus         1 kv~lvG~~~~GKTsl~~~l~   20 (158)
T cd04151           1 RILILGLDNAGKTTILYRLQ   20 (158)
T ss_pred             CEEEECCCCCCHHHHHHHHc
Confidence            79999999999999999984


No 123
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=90.03  E-value=0.2  Score=48.03  Aligned_cols=20  Identities=20%  Similarity=0.501  Sum_probs=18.8

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +|++++|.+++||||+++++
T Consensus         2 ~kv~~vG~~~vGKTsli~~~   21 (165)
T cd04140           2 YRVVVFGAGGVGKSSLVLRF   21 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHH
Confidence            79999999999999999975


No 124
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=90.03  E-value=0.57  Score=45.07  Aligned_cols=36  Identities=8%  Similarity=0.082  Sum_probs=31.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||.+|+ ...+..|.++|.+++++|||.|+++
T Consensus        49 ~~l~i~D~~g~-~~~~~~~~~~~~~~~~~i~v~d~~~   84 (161)
T cd04117          49 VRIQIWDTAGQ-ERYQTITKQYYRRAQGIFLVYDISS   84 (161)
T ss_pred             EEEEEEeCCCc-HhHHhhHHHHhcCCcEEEEEEECCC
Confidence            68899999998 5667789999999999999999885


No 125
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=90.00  E-value=0.21  Score=47.02  Aligned_cols=21  Identities=38%  Similarity=0.480  Sum_probs=19.3

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      .+||+++|.+++||||+++.+
T Consensus         2 ~~ki~i~G~~~~GKtsl~~~~   22 (164)
T cd04145           2 TYKLVVVGGGGVGKSALTIQF   22 (164)
T ss_pred             ceEEEEECCCCCcHHHHHHHH
Confidence            479999999999999999875


No 126
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=89.96  E-value=0.21  Score=48.62  Aligned_cols=21  Identities=33%  Similarity=0.343  Sum_probs=19.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++|+|.+++|||||++++.
T Consensus         1 ~ki~vvG~~gvGKTsli~~~~   21 (158)
T cd04103           1 LKLGIVGNLQSGKSALVHRYL   21 (158)
T ss_pred             CEEEEECCCCCcHHHHHHHHH
Confidence            589999999999999999874


No 127
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=89.94  E-value=0.23  Score=46.35  Aligned_cols=22  Identities=36%  Similarity=0.498  Sum_probs=18.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --.+.++|..||||||++|-+-
T Consensus        11 g~~~~i~G~nGsGKStLl~~l~   32 (137)
T PF00005_consen   11 GEIVAIVGPNGSGKSTLLKALA   32 (137)
T ss_dssp             TSEEEEEESTTSSHHHHHHHHT
T ss_pred             CCEEEEEccCCCccccceeeec
Confidence            3478999999999999998664


No 128
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=89.93  E-value=0.2  Score=49.78  Aligned_cols=20  Identities=30%  Similarity=0.537  Sum_probs=18.6

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +||+|+|..++|||||+.++
T Consensus         1 ~Ki~vvG~~~vGKTSli~~~   20 (191)
T cd04112           1 FKVMLLGDSGVGKTCLLVRF   20 (191)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            58999999999999999877


No 129
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=89.86  E-value=0.22  Score=48.23  Aligned_cols=21  Identities=24%  Similarity=0.379  Sum_probs=19.4

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .||+|+|..++|||||++++.
T Consensus         2 ~kv~l~G~~g~GKTtl~~~~~   22 (180)
T cd04137           2 RKIAVLGSRSVGKSSLTVQFV   22 (180)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            689999999999999999775


No 130
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=89.81  E-value=0.22  Score=49.52  Aligned_cols=21  Identities=14%  Similarity=0.444  Sum_probs=18.9

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .||+|+|.+++|||||++++.
T Consensus         1 ~kivivG~~~vGKTsli~~~~   21 (189)
T cd04134           1 RKVVVLGDGACGKTSLLNVFT   21 (189)
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            389999999999999999863


No 131
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=89.79  E-value=0.24  Score=45.67  Aligned_cols=22  Identities=23%  Similarity=0.309  Sum_probs=19.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      +..|++|+|..+|||||++..+
T Consensus         2 ~~~~i~~~G~~g~GKttl~~~l   23 (168)
T cd04163           2 KSGFVAIVGRPNVGKSTLLNAL   23 (168)
T ss_pred             ceeEEEEECCCCCCHHHHHHHH
Confidence            3578999999999999999986


No 132
>PTZ00132 GTP-binding nuclear protein Ran; Provisional
Probab=89.78  E-value=0.2  Score=50.66  Aligned_cols=23  Identities=39%  Similarity=0.511  Sum_probs=19.9

Q ss_pred             cceeeEEEeecCCCCchhHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ...+|++|+|..++||||+++++
T Consensus         7 ~~~~kv~liG~~g~GKTtLi~~~   29 (215)
T PTZ00132          7 VPEFKLILVGDGGVGKTTFVKRH   29 (215)
T ss_pred             CCCceEEEECCCCCCHHHHHHHH
Confidence            34689999999999999999753


No 133
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=89.76  E-value=0.35  Score=45.78  Aligned_cols=37  Identities=8%  Similarity=0.022  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      ..+++||++|+ ...+..|.+++++++++|||+|+++-
T Consensus        52 ~~l~i~Dt~G~-~~~~~~~~~~~~~~d~ii~v~d~~~~   88 (164)
T cd04101          52 VELFIFDSAGQ-ELYSDMVSNYWESPSVFILVYDVSNK   88 (164)
T ss_pred             EEEEEEECCCH-HHHHHHHHHHhCCCCEEEEEEECcCH
Confidence            78999999998 55566788899999999999999864


No 134
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=89.75  E-value=0.21  Score=48.03  Aligned_cols=21  Identities=24%  Similarity=0.512  Sum_probs=19.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|.+++|||||++++.
T Consensus         1 ~kv~ivG~~~vGKTsl~~~l~   21 (166)
T cd01893           1 VRIVLIGDEGVGKSSLIMSLV   21 (166)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            599999999999999999864


No 135
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=89.75  E-value=0.22  Score=47.65  Aligned_cols=22  Identities=27%  Similarity=0.516  Sum_probs=19.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .+|++++|..++|||||+.++.
T Consensus         2 ~~ki~iiG~~~vGKTsli~~~~   23 (166)
T cd04122           2 IFKYIIIGDMGVGKSCLLHQFT   23 (166)
T ss_pred             ceEEEEECCCCCCHHHHHHHHh
Confidence            3799999999999999999863


No 136
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=89.72  E-value=0.22  Score=47.04  Aligned_cols=21  Identities=38%  Similarity=0.621  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|..++||||++.++.
T Consensus         1 ~ki~v~G~~~~GKSsli~~l~   21 (161)
T cd01863           1 LKILLIGDSGVGKSSLLLRFT   21 (161)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999998863


No 137
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=89.61  E-value=0.24  Score=43.75  Aligned_cols=25  Identities=28%  Similarity=0.421  Sum_probs=20.6

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ..++|.|+.|+||||+++.+--...
T Consensus         3 ~~~~l~G~~G~GKTtl~~~l~~~~~   27 (148)
T smart00382        3 EVILIVGPPGSGKTTLARALARELG   27 (148)
T ss_pred             CEEEEECCCCCcHHHHHHHHHhccC
Confidence            4689999999999999998754444


No 138
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=89.61  E-value=0.46  Score=47.67  Aligned_cols=37  Identities=14%  Similarity=0.132  Sum_probs=32.2

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +++++||+.|| ...+..|..+|.+++++|+|.|+++-
T Consensus        53 ~~l~iwDtaG~-e~~~~~~~~~~~~ad~~ilvyDit~~   89 (182)
T cd04172          53 IELSLWDTSGS-PYYDNVRPLSYPDSDAVLICFDISRP   89 (182)
T ss_pred             EEEEEEECCCc-hhhHhhhhhhcCCCCEEEEEEECCCH
Confidence            78999999998 56677788899999999999998863


No 139
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=89.60  E-value=0.21  Score=49.07  Aligned_cols=24  Identities=29%  Similarity=0.477  Sum_probs=19.9

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      -++|+|..||||||++|++--++.
T Consensus         3 ~~~i~G~sGsGKttl~~~l~~~~~   26 (179)
T TIGR02322         3 LIYVVGPSGAGKDTLLDYARARLA   26 (179)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHcC
Confidence            468999999999999999855443


No 140
>PLN03108 Rab family protein; Provisional
Probab=89.59  E-value=0.23  Score=50.49  Aligned_cols=23  Identities=30%  Similarity=0.486  Sum_probs=20.7

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..+|++|||..++|||||++++.
T Consensus         5 ~~~kivivG~~gvGKStLi~~l~   27 (210)
T PLN03108          5 YLFKYIIIGDTGVGKSCLLLQFT   27 (210)
T ss_pred             cceEEEEECCCCCCHHHHHHHHH
Confidence            45899999999999999999874


No 141
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=89.57  E-value=0.24  Score=46.95  Aligned_cols=20  Identities=15%  Similarity=0.252  Sum_probs=18.1

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +|++++|.++|||||++..+
T Consensus         1 ~ki~vvG~~~~GKtsl~~~l   20 (164)
T cd04101           1 LRCAVVGDPAVGKTAFVQMF   20 (164)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            58999999999999999754


No 142
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=89.56  E-value=0.21  Score=49.93  Aligned_cols=24  Identities=25%  Similarity=0.407  Sum_probs=19.9

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .++|+|+.|||||||+|.+--+..
T Consensus         4 ~i~l~G~sGsGKsTl~~~l~~~~~   27 (186)
T PRK10078          4 LIWLMGPSGSGKDSLLAALRQREQ   27 (186)
T ss_pred             EEEEECCCCCCHHHHHHHHhccCC
Confidence            578999999999999999854433


No 143
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=89.52  E-value=0.24  Score=47.64  Aligned_cols=22  Identities=45%  Similarity=0.626  Sum_probs=20.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .+||+++|..++|||||+.++.
T Consensus         3 ~~ki~vvG~~~~GKSsl~~~~~   24 (167)
T cd01867           3 LFKLLLIGDSGVGKSCLLLRFS   24 (167)
T ss_pred             ceEEEEECCCCCCHHHHHHHHh
Confidence            5899999999999999999874


No 144
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=89.51  E-value=0.24  Score=49.66  Aligned_cols=23  Identities=39%  Similarity=0.599  Sum_probs=20.5

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..+|++++|.+++|||||+.++.
T Consensus         5 ~~~kivvvG~~~vGKTsli~~l~   27 (199)
T cd04110           5 HLFKLLIIGDSGVGKSSLLLRFA   27 (199)
T ss_pred             ceeEEEEECCCCCCHHHHHHHHh
Confidence            46899999999999999998773


No 145
>PTZ00369 Ras-like protein; Provisional
Probab=89.51  E-value=0.48  Score=46.98  Aligned_cols=37  Identities=0%  Similarity=-0.069  Sum_probs=32.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+ ...+..|..++.+++++|+|+|+++-
T Consensus        53 ~~l~i~Dt~G~-~~~~~l~~~~~~~~d~iilv~D~s~~   89 (189)
T PTZ00369         53 CLLDILDTAGQ-EEYSAMRDQYMRTGQGFLCVYSITSR   89 (189)
T ss_pred             EEEEEEeCCCC-ccchhhHHHHhhcCCEEEEEEECCCH
Confidence            57889999998 67778899999999999999999864


No 146
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=89.49  E-value=0.23  Score=49.09  Aligned_cols=21  Identities=24%  Similarity=0.509  Sum_probs=19.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .|++++|..++||||+++++.
T Consensus         2 ~Ki~ivG~~g~GKStLl~~l~   22 (187)
T cd04129           2 RKLVIVGDGACGKTSLLSVFT   22 (187)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            599999999999999999774


No 147
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=89.44  E-value=0.25  Score=47.45  Aligned_cols=20  Identities=25%  Similarity=0.463  Sum_probs=18.0

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      .|++++|..++|||||++++
T Consensus         2 ~ki~iiG~~~~GKTsl~~~~   21 (175)
T cd01870           2 KKLVIVGDGACGKTCLLIVF   21 (175)
T ss_pred             cEEEEECCCCCCHHHHHHHH
Confidence            58999999999999999754


No 148
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=89.36  E-value=0.22  Score=48.23  Aligned_cols=20  Identities=30%  Similarity=0.617  Sum_probs=18.2

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      |++|+|..++||||+++++.
T Consensus         1 ~vvlvG~~~~GKTsl~~~l~   20 (169)
T cd04158           1 RVVTLGLDGAGKTTILFKLK   20 (169)
T ss_pred             CEEEECCCCCCHHHHHHHHh
Confidence            78999999999999999763


No 149
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=89.31  E-value=0.26  Score=48.53  Aligned_cols=22  Identities=18%  Similarity=0.264  Sum_probs=19.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .+|++++|.+++|||||++++.
T Consensus         1 ~~ki~vvG~~~vGKTsl~~~~~   22 (175)
T cd01874           1 TIKCVVVGDGAVGKTCLLISYT   22 (175)
T ss_pred             CeEEEEECCCCCCHHHHHHHHH
Confidence            3799999999999999998764


No 150
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=89.28  E-value=0.23  Score=45.99  Aligned_cols=20  Identities=20%  Similarity=0.411  Sum_probs=18.3

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      +++|+|..++||||+++++.
T Consensus         1 ~i~l~G~~g~GKTtL~~~l~   20 (170)
T cd01876           1 EIAFAGRSNVGKSSLINALT   20 (170)
T ss_pred             CEEEEcCCCCCHHHHHHHHh
Confidence            48999999999999999875


No 151
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=89.20  E-value=0.26  Score=45.60  Aligned_cols=21  Identities=24%  Similarity=0.460  Sum_probs=19.0

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .|++|+|..++||||++..+.
T Consensus         2 ~~i~l~G~~~~GKstli~~l~   22 (157)
T cd04164           2 IKVVIVGKPNVGKSSLLNALA   22 (157)
T ss_pred             cEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999999764


No 152
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=89.17  E-value=0.2  Score=49.91  Aligned_cols=21  Identities=33%  Similarity=0.642  Sum_probs=19.0

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..+++|+|.+++|||||++.+
T Consensus        41 ~~~I~iiG~~g~GKStLl~~l   61 (204)
T cd01878          41 IPTVALVGYTNAGKSTLFNAL   61 (204)
T ss_pred             CCeEEEECCCCCCHHHHHHHH
Confidence            579999999999999999764


No 153
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=89.17  E-value=0.25  Score=48.67  Aligned_cols=21  Identities=29%  Similarity=0.555  Sum_probs=19.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+++|..++|||||++++.
T Consensus         1 ~ki~v~G~~~vGKSsli~~~~   21 (188)
T cd04125           1 FKVVIIGDYGVGKSSLLKRFT   21 (188)
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            589999999999999999874


No 154
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=89.09  E-value=0.35  Score=50.18  Aligned_cols=27  Identities=30%  Similarity=0.370  Sum_probs=23.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      -=.+++.|++|+||||++||+-.|-.|
T Consensus        29 Ge~iaitGPSG~GKStllk~va~Lisp   55 (223)
T COG4619          29 GEFIAITGPSGCGKSTLLKIVASLISP   55 (223)
T ss_pred             CceEEEeCCCCccHHHHHHHHHhccCC
Confidence            345789999999999999999887665


No 155
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=89.07  E-value=0.25  Score=48.58  Aligned_cols=21  Identities=14%  Similarity=0.393  Sum_probs=19.3

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|.+++|||||++++.
T Consensus         1 ~ki~vvG~~~vGKSsLi~~~~   21 (193)
T cd04118           1 VKVVMLGKESVGKTSLVERYV   21 (193)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999999873


No 156
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=89.05  E-value=0.44  Score=45.72  Aligned_cols=36  Identities=6%  Similarity=0.039  Sum_probs=31.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..+|.+++++|||+|+++
T Consensus        50 ~~~~l~Dt~g~-~~~~~~~~~~~~~~~~~l~v~d~~~   85 (165)
T cd01865          50 VKLQIWDTAGQ-ERYRTITTAYYRGAMGFILMYDITN   85 (165)
T ss_pred             EEEEEEECCCh-HHHHHHHHHHccCCcEEEEEEECCC
Confidence            68999999998 5667789999999999999999874


No 157
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=88.87  E-value=0.67  Score=47.51  Aligned_cols=38  Identities=5%  Similarity=-0.033  Sum_probs=33.3

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD  783 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYD  783 (819)
                      +++++||++|+ ...+..|..+|.+++++|+|.|+++-+
T Consensus        44 ~~l~iwDt~G~-e~~~~l~~~~~~~ad~~ilV~D~t~~~   81 (200)
T smart00176       44 IRFNVWDTAGQ-EKFGGLRDGYYIQGQCAIIMFDVTARV   81 (200)
T ss_pred             EEEEEEECCCc-hhhhhhhHHHhcCCCEEEEEEECCChH
Confidence            78999999998 566777888999999999999998643


No 158
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=88.79  E-value=0.75  Score=45.03  Aligned_cols=36  Identities=17%  Similarity=0.242  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ......|..+|.+++++|||.|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~ad~~ilv~d~~~   84 (170)
T cd04108          49 FSLQLWDTAGQ-ERFKCIASTYYRGAQAIIIVFDLTD   84 (170)
T ss_pred             EEEEEEeCCCh-HHHHhhHHHHhcCCCEEEEEEECcC
Confidence            68999999998 5667788889999999999999976


No 159
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=88.78  E-value=0.28  Score=46.66  Aligned_cols=22  Identities=32%  Similarity=0.424  Sum_probs=19.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.|++++|..++||||+++.+.
T Consensus         1 ~~ki~~~G~~~~GKTsli~~~~   22 (164)
T cd04175           1 EYKLVVLGSGGVGKSALTVQFV   22 (164)
T ss_pred             CcEEEEECCCCCCHHHHHHHHH
Confidence            4699999999999999988754


No 160
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate. The resulting product gluconate-6-phoshate is an important precursor of gluconate metabolism. GntK acts as a dimmer composed of two identical subunits.
Probab=88.78  E-value=0.27  Score=46.87  Aligned_cols=21  Identities=38%  Similarity=0.499  Sum_probs=18.0

Q ss_pred             EEEeecCCCCchhHHHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKIL  554 (819)
                      ++|.|..+|||||+.|++.-.
T Consensus         2 i~l~G~~GsGKST~a~~l~~~   22 (150)
T cd02021           2 IVVMGVSGSGKSTVGKALAER   22 (150)
T ss_pred             EEEEcCCCCCHHHHHHHHHhh
Confidence            678999999999999987543


No 161
>PRK03839 putative kinase; Provisional
Probab=88.77  E-value=0.27  Score=48.53  Aligned_cols=24  Identities=21%  Similarity=0.272  Sum_probs=20.2

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +|+|+|..||||||+.|++--.++
T Consensus         2 ~I~l~G~pGsGKsT~~~~La~~~~   25 (180)
T PRK03839          2 IIAITGTPGVGKTTVSKLLAEKLG   25 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhC
Confidence            689999999999999998854444


No 162
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=88.77  E-value=0.28  Score=47.67  Aligned_cols=21  Identities=43%  Similarity=0.624  Sum_probs=18.8

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .||+++|..++|||||+.++.
T Consensus         1 ~ki~vvG~~~vGKTsli~~~~   21 (166)
T cd00877           1 FKLVLVGDGGTGKTTFVKRHL   21 (166)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            489999999999999998663


No 163
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=88.73  E-value=0.28  Score=47.94  Aligned_cols=21  Identities=24%  Similarity=0.506  Sum_probs=19.1

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|..++||||++.++.
T Consensus         1 ~ki~vvG~~~vGKTsli~~l~   21 (187)
T cd04132           1 KKIVVVGDGGCGKTCLLIVYS   21 (187)
T ss_pred             CeEEEECCCCCCHHHHHHHHH
Confidence            599999999999999999863


No 164
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=88.70  E-value=0.28  Score=45.08  Aligned_cols=20  Identities=30%  Similarity=0.496  Sum_probs=17.7

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      .++|+|..++||||+++++.
T Consensus         1 ~i~i~G~~~~GKssl~~~l~   20 (159)
T cd04159           1 EITLVGLQNSGKTTLVNVIA   20 (159)
T ss_pred             CEEEEcCCCCCHHHHHHHHc
Confidence            37899999999999999773


No 165
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=88.68  E-value=0.27  Score=46.32  Aligned_cols=20  Identities=35%  Similarity=0.630  Sum_probs=18.4

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      ||+++|..++||||+++++.
T Consensus         1 ~i~i~G~~~~GKTsl~~~~~   20 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYKLK   20 (160)
T ss_pred             CEEEEcCCCCCHHHHHHHHh
Confidence            68999999999999999874


No 166
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=88.66  E-value=0.3  Score=47.09  Aligned_cols=22  Identities=32%  Similarity=0.537  Sum_probs=20.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..|++++|..++|||||+.++.
T Consensus         4 ~~ki~vvG~~~vGKSsLl~~l~   25 (168)
T cd01866           4 LFKYIIIGDTGVGKSCLLLQFT   25 (168)
T ss_pred             ceEEEEECCCCCCHHHHHHHHH
Confidence            5799999999999999999863


No 167
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=88.52  E-value=0.3  Score=47.98  Aligned_cols=25  Identities=16%  Similarity=0.252  Sum_probs=22.1

Q ss_pred             hcceeeEEEeecCCCCchhHHHHHH
Q 003444          528 RRTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       528 ~k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .++..|++++|..++|||||++++.
T Consensus        15 ~~~~~~i~ivG~~~~GKStlin~l~   39 (179)
T TIGR03598        15 PDDGPEIAFAGRSNVGKSSLINALT   39 (179)
T ss_pred             CCCCCEEEEEcCCCCCHHHHHHHHh
Confidence            3678899999999999999999774


No 168
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, and recognition of specific DNA stru
Probab=88.31  E-value=0.31  Score=49.33  Aligned_cols=21  Identities=29%  Similarity=0.401  Sum_probs=19.7

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      -+++|+|+.+|||||++|++-
T Consensus        30 ~~~~l~G~Ng~GKStll~~i~   50 (202)
T cd03243          30 RLLLITGPNMGGKSTYLRSIG   50 (202)
T ss_pred             eEEEEECCCCCccHHHHHHHH
Confidence            578999999999999999987


No 169
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=88.23  E-value=0.3  Score=47.85  Aligned_cols=22  Identities=32%  Similarity=0.366  Sum_probs=18.8

Q ss_pred             eEEEeecCCCCchhHHHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .++|+|+.+|||||++|.+.-.
T Consensus         3 ii~l~G~~GsGKsTl~~~L~~~   24 (180)
T TIGR03263         3 LIVISGPSGVGKSTLVKALLEE   24 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHcc
Confidence            4789999999999999888543


No 170
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=88.21  E-value=0.6  Score=43.97  Aligned_cols=36  Identities=3%  Similarity=0.015  Sum_probs=31.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||+.|+ ...+..|..++.+++++|||+++++
T Consensus        50 ~~~~i~Dt~G~-~~~~~~~~~~~~~~~~~ilv~d~~~   85 (164)
T cd04145          50 AILDILDTAGQ-EEFSAMREQYMRTGEGFLLVFSVTD   85 (164)
T ss_pred             EEEEEEECCCC-cchhHHHHHHHhhCCEEEEEEECCC
Confidence            67899999998 5666677888999999999999986


No 171
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=88.21  E-value=0.33  Score=48.02  Aligned_cols=21  Identities=14%  Similarity=0.433  Sum_probs=19.8

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      .+||+++|..+|||||+++++
T Consensus         3 ~~kv~~vG~~~~GKTsli~~~   23 (183)
T cd04152           3 SLHIVMLGLDSAGKTTVLYRL   23 (183)
T ss_pred             ceEEEEECCCCCCHHHHHHHH
Confidence            589999999999999999987


No 172
>PRK14532 adenylate kinase; Provisional
Probab=88.15  E-value=0.32  Score=48.26  Aligned_cols=23  Identities=26%  Similarity=0.249  Sum_probs=19.4

Q ss_pred             eEEEeecCCCCchhHHHHHHHHh
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy  555 (819)
                      +|+|+|..||||||+.+.+-=-|
T Consensus         2 ~i~~~G~pGsGKsT~a~~la~~~   24 (188)
T PRK14532          2 NLILFGPPAAGKGTQAKRLVEER   24 (188)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHc
Confidence            69999999999999998874333


No 173
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=88.14  E-value=0.45  Score=49.18  Aligned_cols=23  Identities=26%  Similarity=0.498  Sum_probs=20.7

Q ss_pred             EEEeecCCCCchhHHHHHHHHhc
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ..++|+.||||||+++++..+++
T Consensus        28 ~~ivGpNGaGKSTll~~i~~~~G   50 (212)
T cd03274          28 SAIVGPNGSGKSNVIDSMLFVFG   50 (212)
T ss_pred             EEEECCCCCCHHHHHHHHHHHhc
Confidence            46899999999999999988776


No 174
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=88.12  E-value=0.98  Score=46.52  Aligned_cols=37  Identities=5%  Similarity=-0.064  Sum_probs=32.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +++++||++|+ ...+.-|..+|.+++++|||+|+++-
T Consensus        62 ~~l~i~Dt~G~-~~~~~~~~~~~~~~~~~ilvfD~~~~   98 (219)
T PLN03071         62 IRFYCWDTAGQ-EKFGGLRDGYYIHGQCAIIMFDVTAR   98 (219)
T ss_pred             EEEEEEECCCc-hhhhhhhHHHcccccEEEEEEeCCCH
Confidence            68999999998 66778888899999999999999864


No 175
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=88.10  E-value=0.7  Score=43.64  Aligned_cols=36  Identities=6%  Similarity=0.026  Sum_probs=31.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||.+|+ ......|..++.+++++|||+|+++
T Consensus        49 ~~~~l~D~~g~-~~~~~~~~~~~~~~d~~i~v~d~~~   84 (161)
T cd01863          49 VKLAIWDTAGQ-ERFRTLTSSYYRGAQGVILVYDVTR   84 (161)
T ss_pred             EEEEEEECCCc-hhhhhhhHHHhCCCCEEEEEEECCC
Confidence            67899999998 5666778889999999999999885


No 176
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=88.04  E-value=0.36  Score=45.78  Aligned_cols=21  Identities=29%  Similarity=0.436  Sum_probs=18.5

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      .+|++|+|..++|||||+..+
T Consensus         1 ~~ki~i~G~~~vGKTsl~~~~   21 (163)
T cd04176           1 EYKVVVLGSGGVGKSALTVQF   21 (163)
T ss_pred             CeEEEEECCCCCCHHHHHHHH
Confidence            369999999999999998654


No 177
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=87.95  E-value=0.32  Score=49.83  Aligned_cols=21  Identities=29%  Similarity=0.526  Sum_probs=18.4

Q ss_pred             eEEEeecCCCCchhHHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAKI  553 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKI  553 (819)
                      -++|+|+.+|||||++|++-.
T Consensus        27 ~~~ltGpNg~GKSTllr~i~~   47 (199)
T cd03283          27 GILITGSNMSGKSTFLRTIGV   47 (199)
T ss_pred             EEEEECCCCCChHHHHHHHHH
Confidence            457999999999999999863


No 178
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=87.93  E-value=0.33  Score=47.21  Aligned_cols=20  Identities=30%  Similarity=0.519  Sum_probs=18.2

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      +|+++|.+++|||||++++.
T Consensus         1 ~i~~~G~~~~GKTsl~~~l~   20 (167)
T cd04161           1 TLLTVGLDNAGKTTLVSALQ   20 (167)
T ss_pred             CEEEECCCCCCHHHHHHHHh
Confidence            58999999999999999775


No 179
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=87.87  E-value=0.35  Score=45.04  Aligned_cols=19  Identities=21%  Similarity=0.653  Sum_probs=17.8

Q ss_pred             eEEEeecCCCCchhHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQM  551 (819)
                      |++|+|.+++||||++.++
T Consensus         2 kv~liG~~~vGKSsL~~~l   20 (142)
T TIGR02528         2 RIMFIGSVGCGKTTLTQAL   20 (142)
T ss_pred             eEEEECCCCCCHHHHHHHH
Confidence            8999999999999999875


No 180
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for homeostasis of adenosine phosphates.
Probab=87.80  E-value=0.33  Score=47.83  Aligned_cols=24  Identities=33%  Similarity=0.515  Sum_probs=20.5

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +|+|+|+.+|||||+.+++.=.|+
T Consensus         1 ~I~i~G~pGsGKst~a~~La~~~~   24 (194)
T cd01428           1 RILLLGPPGSGKGTQAERLAKKYG   24 (194)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHcC
Confidence            589999999999999998865544


No 181
>PRK13949 shikimate kinase; Provisional
Probab=87.79  E-value=0.35  Score=48.28  Aligned_cols=20  Identities=35%  Similarity=0.617  Sum_probs=18.5

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      ||+|+|..+|||||+.|.+-
T Consensus         3 ~I~liG~~GsGKstl~~~La   22 (169)
T PRK13949          3 RIFLVGYMGAGKTTLGKALA   22 (169)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            79999999999999999874


No 182
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=87.67  E-value=0.52  Score=50.07  Aligned_cols=38  Identities=32%  Similarity=0.386  Sum_probs=29.4

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhcC------------CCCCHHHhhhhHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYKA------------VPFSDDEHENIKL  570 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~p------------~GFS~eEr~~~K~  570 (819)
                      -+.++|++||||||++.-+=.|-.|            ..++++++..+|.
T Consensus        33 ~vaI~GpSGSGKSTLLniig~ld~pt~G~v~i~g~d~~~l~~~~~~~~R~   82 (226)
T COG1136          33 FVAIVGPSGSGKSTLLNLLGGLDKPTSGEVLINGKDLTKLSEKELAKLRR   82 (226)
T ss_pred             EEEEECCCCCCHHHHHHHHhcccCCCCceEEECCEEcCcCCHHHHHHHHH
Confidence            4678999999999999988766655            2356777777663


No 183
>PTZ00369 Ras-like protein; Provisional
Probab=87.65  E-value=0.39  Score=47.60  Aligned_cols=23  Identities=39%  Similarity=0.423  Sum_probs=20.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..+||+++|..++|||||++.+.
T Consensus         4 ~~~Ki~iiG~~~~GKTsLi~~~~   26 (189)
T PTZ00369          4 TEYKLVVVGGGGVGKSALTIQFI   26 (189)
T ss_pred             cceEEEEECCCCCCHHHHHHHHh
Confidence            36899999999999999988643


No 184
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=87.65  E-value=0.35  Score=45.50  Aligned_cols=20  Identities=45%  Similarity=0.703  Sum_probs=17.9

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      +++|+|..++||||+++++.
T Consensus         1 ~i~~vG~~~~GKTsl~~~l~   20 (162)
T cd04157           1 NILVVGLDNSGKTTIINQLK   20 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHc
Confidence            58999999999999998864


No 185
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=87.65  E-value=0.3  Score=47.23  Aligned_cols=21  Identities=38%  Similarity=0.523  Sum_probs=18.0

Q ss_pred             EEEeecCCCCchhHHHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKIL  554 (819)
                      ++|.|..||||||+.+++.-.
T Consensus         1 i~l~G~~GsGKSTla~~l~~~   21 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASALAHR   21 (163)
T ss_pred             CEEECCCCCCHHHHHHHHHHh
Confidence            478999999999999987643


No 186
>PF13521 AAA_28:  AAA domain; PDB: 1LW7_A.
Probab=87.59  E-value=0.3  Score=47.47  Aligned_cols=22  Identities=14%  Similarity=0.424  Sum_probs=17.4

Q ss_pred             eEEEeecCCCCchhHHHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKIL  554 (819)
                      ||.|.|+.++||||+++++.-.
T Consensus         1 rI~i~G~~stGKTTL~~~L~~~   22 (163)
T PF13521_consen    1 RIVITGGPSTGKTTLIEALAAR   22 (163)
T ss_dssp             -EEEE--TTSHHHHHHHHHHHH
T ss_pred             CEEEECCCCCCHHHHHHHHHHc
Confidence            7999999999999999998755


No 187
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=87.58  E-value=0.37  Score=46.73  Aligned_cols=20  Identities=25%  Similarity=0.375  Sum_probs=18.0

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +|++++|..++||||+++++
T Consensus         1 ~k~~i~G~~~~GKtsl~~~~   20 (173)
T cd04130           1 LKCVLVGDGAVGKTSLIVSY   20 (173)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            58999999999999998754


No 188
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=87.50  E-value=0.88  Score=45.31  Aligned_cols=36  Identities=14%  Similarity=0.169  Sum_probs=31.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +++++||+.|| ...+..+..+|.+++++|+|.|+++
T Consensus        49 ~~l~iwDt~G~-~~~~~~~~~~~~~a~~~ilvfdit~   84 (178)
T cd04131          49 IELSLWDTSGS-PYYDNVRPLCYPDSDAVLICFDISR   84 (178)
T ss_pred             EEEEEEECCCc-hhhhhcchhhcCCCCEEEEEEECCC
Confidence            78999999998 5556667778999999999999985


No 189
>PF05729 NACHT:  NACHT domain
Probab=87.37  E-value=0.39  Score=45.22  Aligned_cols=18  Identities=39%  Similarity=0.687  Sum_probs=16.2

Q ss_pred             EEEeecCCCCchhHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQM  551 (819)
                      |+|.|.+|+||||+++.+
T Consensus         3 l~I~G~~G~GKStll~~~   20 (166)
T PF05729_consen    3 LWISGEPGSGKSTLLRKL   20 (166)
T ss_pred             EEEECCCCCChHHHHHHH
Confidence            678999999999999865


No 190
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=87.36  E-value=0.43  Score=47.70  Aligned_cols=22  Identities=18%  Similarity=0.212  Sum_probs=19.9

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .+|++++|.+++|||||+.++.
T Consensus         3 ~~ki~~vG~~~vGKTsli~~~~   24 (191)
T cd01875           3 SIKCVVVGDGAVGKTCLLICYT   24 (191)
T ss_pred             cEEEEEECCCCCCHHHHHHHHH
Confidence            4799999999999999999864


No 191
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=87.35  E-value=0.37  Score=49.04  Aligned_cols=20  Identities=15%  Similarity=0.429  Sum_probs=18.7

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +||+++|.+++|||||+.++
T Consensus         1 ~Ki~ivG~~~vGKSsLi~~l   20 (215)
T cd04109           1 FKIVVLGDGAVGKTSLCRRF   20 (215)
T ss_pred             CEEEEECcCCCCHHHHHHHH
Confidence            58999999999999999986


No 192
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=87.35  E-value=0.37  Score=47.12  Aligned_cols=21  Identities=29%  Similarity=0.498  Sum_probs=18.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      -.++++|..||||||+.+.+-
T Consensus         4 ~ii~i~G~~GsGKsTl~~~l~   24 (188)
T TIGR01360         4 KIIFIVGGPGSGKGTQCEKIV   24 (188)
T ss_pred             cEEEEECCCCCCHHHHHHHHH
Confidence            357889999999999998774


No 193
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=87.31  E-value=0.38  Score=45.41  Aligned_cols=20  Identities=35%  Similarity=0.758  Sum_probs=18.3

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      ||+++|..++||||+++++-
T Consensus         1 ki~iiG~~~~GKssli~~~~   20 (158)
T cd00878           1 RILILGLDGAGKTTILYKLK   20 (158)
T ss_pred             CEEEEcCCCCCHHHHHHHHh
Confidence            79999999999999998764


No 194
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=87.24  E-value=0.35  Score=51.31  Aligned_cols=27  Identities=41%  Similarity=0.575  Sum_probs=23.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      --.++|+|+.||||||++|.+--|..|
T Consensus        30 Ge~~~i~G~nGsGKSTL~~~l~GLl~p   56 (235)
T COG1122          30 GERVLLIGPNGSGKSTLLKLLNGLLKP   56 (235)
T ss_pred             CCEEEEECCCCCCHHHHHHHHcCcCcC
Confidence            457899999999999999999877665


No 195
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=87.21  E-value=0.41  Score=45.64  Aligned_cols=36  Identities=8%  Similarity=0.092  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ......|..+|.+++++|||+|+++
T Consensus        51 ~~~~i~D~~G~-~~~~~~~~~~~~~~~~ii~v~d~~~   86 (166)
T cd01869          51 IKLQIWDTAGQ-ERFRTITSSYYRGAHGIIIVYDVTD   86 (166)
T ss_pred             EEEEEEECCCc-HhHHHHHHHHhCcCCEEEEEEECcC
Confidence            67899999998 5667778889999999999999986


No 196
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=87.18  E-value=0.4  Score=46.94  Aligned_cols=20  Identities=20%  Similarity=0.375  Sum_probs=18.7

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      ||+++|..++|||||++|+.
T Consensus         2 ki~ivG~~~vGKTsli~~~~   21 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFC   21 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHh
Confidence            89999999999999999874


No 197
>TIGR01351 adk adenylate kinases. Adenylate kinase (EC 2.7.4.3) converts ATP + AMP to ADP + ADP, that is, uses ATP as a phosphate donor for AMP. Most members of this family are known or believed to be adenylate kinase. However, some members accept other nucleotide triphosphates as donors, may be unable to use ATP, and may fail to complement adenylate kinase mutants. An example of a nucleoside-triphosphate--adenylate kinase (EC 2.7.4.10) is a GTP:AMP phosphotransferase. This family is designated subfamily rather than equivalog for this reason.
Probab=87.11  E-value=0.37  Score=49.08  Aligned_cols=24  Identities=38%  Similarity=0.526  Sum_probs=20.1

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ||+|+|+.||||||+.+++-=-|+
T Consensus         1 rI~i~G~pGsGKsT~a~~La~~~g   24 (210)
T TIGR01351         1 RLVLLGPPGSGKGTQAKRIAEKYG   24 (210)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHcC
Confidence            689999999999999998754443


No 198
>PRK00300 gmk guanylate kinase; Provisional
Probab=86.91  E-value=0.4  Score=48.06  Aligned_cols=24  Identities=33%  Similarity=0.329  Sum_probs=19.9

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHh
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .-++|+|+.||||||+++++--.+
T Consensus         6 ~~i~i~G~sGsGKstl~~~l~~~~   29 (205)
T PRK00300          6 LLIVLSGPSGAGKSTLVKALLERD   29 (205)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhC
Confidence            457899999999999999985443


No 199
>PRK08233 hypothetical protein; Provisional
Probab=86.75  E-value=0.47  Score=46.17  Aligned_cols=21  Identities=19%  Similarity=0.420  Sum_probs=17.8

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .-|.+.|.+||||||+.+++.
T Consensus         4 ~iI~I~G~~GsGKtTla~~L~   24 (182)
T PRK08233          4 KIITIAAVSGGGKTTLTERLT   24 (182)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            446678999999999999885


No 200
>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=86.74  E-value=0.62  Score=48.81  Aligned_cols=38  Identities=8%  Similarity=0.101  Sum_probs=33.6

Q ss_pred             ccccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          743 SLLRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       743 ~~l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++|+||..|| ...|.--.+||.++++||||-|+++
T Consensus        56 k~iKlQIWDTAGQ-ERFrtit~syYR~ahGii~vyDiT~   93 (205)
T KOG0084|consen   56 KTIKLQIWDTAGQ-ERFRTITSSYYRGAHGIIFVYDITK   93 (205)
T ss_pred             eEEEEEeeecccc-HHHhhhhHhhccCCCeEEEEEEccc
Confidence            3489999999999 6777778899999999999999885


No 201
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=86.69  E-value=0.47  Score=46.73  Aligned_cols=21  Identities=19%  Similarity=0.297  Sum_probs=18.9

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|++++|..++|||||++++.
T Consensus         2 ~ki~iiG~~~vGKSsli~~~~   22 (174)
T cd01871           2 IKCVVVGDGAVGKTCLLISYT   22 (174)
T ss_pred             eEEEEECCCCCCHHHHHHHHh
Confidence            699999999999999998653


No 202
>PRK13695 putative NTPase; Provisional
Probab=86.68  E-value=0.43  Score=47.03  Aligned_cols=20  Identities=25%  Similarity=0.419  Sum_probs=18.1

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      .|++|.|..|+||||+++++
T Consensus         1 ~~i~ltG~~G~GKTTll~~i   20 (174)
T PRK13695          1 MKIGITGPPGVGKTTLVLKI   20 (174)
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            48999999999999999974


No 203
>PTZ00088 adenylate kinase 1; Provisional
Probab=86.66  E-value=0.48  Score=49.95  Aligned_cols=28  Identities=21%  Similarity=0.277  Sum_probs=22.8

Q ss_pred             cceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +..+||+|+|+.||||||+.+++-=.|+
T Consensus         4 ~~~mrIvl~G~PGsGK~T~a~~La~~~g   31 (229)
T PTZ00088          4 KGPLKIVLFGAPGVGKGTFAEILSKKEN   31 (229)
T ss_pred             CCCceEEEECCCCCCHHHHHHHHHHHhC
Confidence            3457899999999999999998754444


No 204
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=86.64  E-value=0.45  Score=48.94  Aligned_cols=23  Identities=35%  Similarity=0.528  Sum_probs=20.5

Q ss_pred             cceeeEEEeecCCCCchhHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ...+||+++|..++|||||+.++
T Consensus        11 ~~~~Ki~vvG~~gvGKTsli~~~   33 (219)
T PLN03071         11 YPSFKLVIVGDGGTGKTTFVKRH   33 (219)
T ss_pred             CCceEEEEECcCCCCHHHHHHHH
Confidence            44689999999999999999874


No 205
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=86.53  E-value=0.46  Score=48.52  Aligned_cols=22  Identities=27%  Similarity=0.477  Sum_probs=20.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.||+++|..++||||++.++-
T Consensus         2 ~~KIvvvG~~~vGKTsLi~~l~   23 (211)
T cd04111           2 QFRLIVIGDSTVGKSSLLKRFT   23 (211)
T ss_pred             ceEEEEECCCCCCHHHHHHHHH
Confidence            5899999999999999999863


No 206
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=86.49  E-value=0.46  Score=43.23  Aligned_cols=19  Identities=32%  Similarity=0.578  Sum_probs=17.1

Q ss_pred             EEEeecCCCCchhHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMK  552 (819)
                      |||.|+.|+||||+++.+=
T Consensus         1 ill~G~~G~GKT~l~~~la   19 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARALA   19 (132)
T ss_dssp             EEEESSTTSSHHHHHHHHH
T ss_pred             CEEECcCCCCeeHHHHHHH
Confidence            7999999999999998763


No 207
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family also possess a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined. Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding clamps, a
Probab=86.46  E-value=0.47  Score=48.11  Aligned_cols=20  Identities=20%  Similarity=0.380  Sum_probs=18.4

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      .++|.|+.+|||||++|++-
T Consensus        30 ~~~ltG~Ng~GKStll~~i~   49 (200)
T cd03280          30 VLVITGPNAGGKTVTLKTLG   49 (200)
T ss_pred             EEEEECCCCCChHHHHHHHH
Confidence            49999999999999999976


No 208
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=86.42  E-value=0.87  Score=44.02  Aligned_cols=36  Identities=11%  Similarity=0.228  Sum_probs=29.8

Q ss_pred             ccEEEEEecccccccc-cccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGEN-CKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsER-kKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+ ..|.+++.+++++|||+|+++
T Consensus        51 ~~~~i~Dt~G~-~~~~~~~~~~~~~~~d~~i~v~d~~~   87 (170)
T cd04115          51 IKVQLWDTAGQ-ERFRKSMVQHYYRNVHAVVFVYDVTN   87 (170)
T ss_pred             EEEEEEeCCCh-HHHHHhhHHHhhcCCCEEEEEEECCC
Confidence            68999999998 3333 358889999999999999974


No 209
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=86.33  E-value=0.45  Score=48.80  Aligned_cols=26  Identities=23%  Similarity=0.318  Sum_probs=20.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-|-=++
T Consensus        25 ~Ge~~~l~G~nGsGKSTLl~~l~Gl~   50 (236)
T cd03219          25 PGEIHGLIGPNGAGKTTLFNLISGFL   50 (236)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHcCCC
Confidence            34568999999999999999885433


No 210
>PF13173 AAA_14:  AAA domain
Probab=86.26  E-value=0.47  Score=44.64  Aligned_cols=19  Identities=37%  Similarity=0.672  Sum_probs=17.2

Q ss_pred             EEEeecCCCCchhHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMK  552 (819)
                      ++|.|+-++||||++||+-
T Consensus         5 ~~l~G~R~vGKTtll~~~~   23 (128)
T PF13173_consen    5 IILTGPRGVGKTTLLKQLA   23 (128)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            6789999999999999983


No 211
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=86.24  E-value=0.54  Score=46.17  Aligned_cols=23  Identities=22%  Similarity=0.364  Sum_probs=19.2

Q ss_pred             EEEeecCCCCchhHHHHHHHHhc
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ++++|+.||||||+.+++.--++
T Consensus         2 i~i~G~pGsGKst~a~~la~~~~   24 (183)
T TIGR01359         2 VFVLGGPGSGKGTQCAKIVENFG   24 (183)
T ss_pred             EEEECCCCCCHHHHHHHHHHHcC
Confidence            68999999999999998754444


No 212
>PRK14530 adenylate kinase; Provisional
Probab=86.23  E-value=0.56  Score=48.01  Aligned_cols=24  Identities=25%  Similarity=0.461  Sum_probs=20.7

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +|+|+|+.||||||+.+.+--.|+
T Consensus         5 ~I~i~G~pGsGKsT~~~~La~~~~   28 (215)
T PRK14530          5 RILLLGAPGAGKGTQSSNLAEEFG   28 (215)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhC
Confidence            799999999999999998854444


No 213
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=86.18  E-value=0.5  Score=46.31  Aligned_cols=26  Identities=15%  Similarity=0.236  Sum_probs=22.3

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHH
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ......|++|+|..++||||+++.+.
T Consensus        20 ~~~~~~~v~ivG~~~~GKSsli~~l~   45 (196)
T PRK00454         20 PPDDGPEIAFAGRSNVGKSSLINALT   45 (196)
T ss_pred             CCCCCCEEEEEcCCCCCHHHHHHHHh
Confidence            34467899999999999999999774


No 214
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=86.12  E-value=0.48  Score=47.79  Aligned_cols=27  Identities=33%  Similarity=0.303  Sum_probs=21.7

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        26 ~G~~~~i~G~nGsGKSTLl~~l~G~~~   52 (214)
T cd03292          26 AGEFVFLVGPSGAGKSTLLKLIYKEEL   52 (214)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            345788999999999999998854443


No 215
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-inactivating enzyme; modifies the primary (C-3) hydroxyl of the antibiotic. Related structurally to shikimate kinase II.
Probab=86.11  E-value=0.62  Score=46.10  Aligned_cols=22  Identities=27%  Similarity=0.465  Sum_probs=18.8

Q ss_pred             EEEeecCCCCchhHHHHHHHHh
Q 003444          534 LLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy  555 (819)
                      |+|.|.++|||||+.|++.-..
T Consensus         5 i~l~G~~gsGKst~a~~l~~~~   26 (175)
T cd00227           5 IILNGGSSAGKSSIARALQSVL   26 (175)
T ss_pred             EEEECCCCCCHHHHHHHHHHhh
Confidence            7889999999999999886443


No 216
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=86.07  E-value=1.4  Score=42.25  Aligned_cols=36  Identities=8%  Similarity=0.179  Sum_probs=30.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+.-|..++.+++++|||.|+++
T Consensus        46 ~~~~i~Dt~G~-~~~~~~~~~~~~~~d~~ilv~d~~~   81 (174)
T smart00174       46 VELGLWDTAGQ-EDYDRLRPLSYPDTDVFLICFSVDS   81 (174)
T ss_pred             EEEEEEECCCC-cccchhchhhcCCCCEEEEEEECCC
Confidence            67999999998 5556677778999999999999875


No 217
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=85.92  E-value=0.5  Score=47.91  Aligned_cols=26  Identities=35%  Similarity=0.321  Sum_probs=20.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        29 ~G~~~~l~G~nGsGKSTLl~~i~Gl~   54 (218)
T cd03255          29 KGEFVAIVGPSGSGKSTLLNILGGLD   54 (218)
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHhCCc
Confidence            34578999999999999999875443


No 218
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=85.91  E-value=0.55  Score=47.76  Aligned_cols=24  Identities=25%  Similarity=0.191  Sum_probs=19.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      ..-|.+.|.+||||||++|++.-+
T Consensus         6 g~vi~I~G~sGsGKSTl~~~l~~~   29 (207)
T TIGR00235         6 GIIIGIGGGSGSGKTTVARKIYEQ   29 (207)
T ss_pred             eEEEEEECCCCCCHHHHHHHHHHH
Confidence            345779999999999999998644


No 219
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=85.90  E-value=0.5  Score=47.84  Aligned_cols=22  Identities=32%  Similarity=0.492  Sum_probs=18.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      .--++.|+|+.||||||+||-+
T Consensus        20 ~G~~~~l~G~nG~GKSTLl~~i   41 (176)
T cd03238          20 LNVLVVVTGVSGSGKSTLVNEG   41 (176)
T ss_pred             CCCEEEEECCCCCCHHHHHHHH
Confidence            3457899999999999999865


No 220
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=85.87  E-value=0.57  Score=45.16  Aligned_cols=23  Identities=35%  Similarity=0.531  Sum_probs=19.3

Q ss_pred             EEEeecCCCCchhHHHHHHHHhc
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ++|+|+.+|||||+++++.-.+.
T Consensus         2 i~i~GpsGsGKstl~~~L~~~~~   24 (137)
T cd00071           2 IVLSGPSGVGKSTLLKRLLEEFD   24 (137)
T ss_pred             EEEECCCCCCHHHHHHHHHhcCC
Confidence            57899999999999999865543


No 221
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=85.86  E-value=0.92  Score=47.88  Aligned_cols=38  Identities=13%  Similarity=0.162  Sum_probs=32.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD  783 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYD  783 (819)
                      +.++|||++|| ...+..|..+|.+++++|+|.|+++-+
T Consensus        61 v~l~iwDTaG~-e~~~~~~~~~~~~ad~vIlVyDit~~~   98 (232)
T cd04174          61 VELSLWDTSGS-PYYDNVRPLCYSDSDAVLLCFDISRPE   98 (232)
T ss_pred             EEEEEEeCCCc-hhhHHHHHHHcCCCcEEEEEEECCChH
Confidence            78999999998 555666778999999999999998643


No 222
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=85.78  E-value=0.51  Score=47.58  Aligned_cols=25  Identities=28%  Similarity=0.307  Sum_probs=20.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|+.||||||++|-+-=++
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~Gl~   50 (205)
T cd03226          26 GEIIALTGKNGAGKTTLAKILAGLI   50 (205)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCC
Confidence            4578999999999999999875443


No 223
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=85.75  E-value=1.2  Score=43.15  Aligned_cols=36  Identities=6%  Similarity=0.008  Sum_probs=30.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||+.|+ ......|.++|.+++++|||.|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~~d~~i~v~d~~~   84 (166)
T cd00877          49 IRFNVWDTAGQ-EKFGGLRDGYYIGGQCAIIMFDVTS   84 (166)
T ss_pred             EEEEEEECCCC-hhhccccHHHhcCCCEEEEEEECCC
Confidence            68999999998 5555667788999999999999884


No 224
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=85.74  E-value=0.48  Score=47.96  Aligned_cols=23  Identities=39%  Similarity=0.507  Sum_probs=20.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..+||+++|.+++|||||++++.
T Consensus         5 ~~~KivviG~~~vGKTsll~~~~   27 (189)
T cd04121           5 YLLKFLLVGDSDVGKGEILASLQ   27 (189)
T ss_pred             ceeEEEEECCCCCCHHHHHHHHH
Confidence            46899999999999999998874


No 225
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=85.66  E-value=0.48  Score=50.51  Aligned_cols=28  Identities=29%  Similarity=0.407  Sum_probs=23.5

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +--.+.++|++||||||+++-+-.|..+
T Consensus        27 ~Gevv~iiGpSGSGKSTlLRclN~LE~~   54 (240)
T COG1126          27 KGEVVVIIGPSGSGKSTLLRCLNGLEEP   54 (240)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCcCC
Confidence            3456889999999999999999877654


No 226
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=85.66  E-value=0.52  Score=47.50  Aligned_cols=26  Identities=31%  Similarity=0.517  Sum_probs=21.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+==++
T Consensus        25 ~G~~~~l~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03262          25 KGEVVVIIGPSGSGKSTLLRCINLLE   50 (213)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34578999999999999999875443


No 227
>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family.
Probab=85.63  E-value=0.58  Score=47.00  Aligned_cols=21  Identities=24%  Similarity=0.499  Sum_probs=18.8

Q ss_pred             EEEeecCCCCchhHHHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKIL  554 (819)
                      ++|.|+..|||||++|++-++
T Consensus         2 ~~ltG~N~~GKst~l~~i~~~   22 (185)
T smart00534        2 VIITGPNMGGKSTYLRQVGLI   22 (185)
T ss_pred             EEEECCCCCcHHHHHHHHHHH
Confidence            689999999999999999754


No 228
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=85.59  E-value=1.6  Score=45.50  Aligned_cols=36  Identities=11%  Similarity=-0.007  Sum_probs=31.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+.+||++|+ ...+..|..+|.+++++|||.|+++
T Consensus        44 ~~l~iwDt~G~-e~~~~l~~~~~~~ad~~IlV~Dvt~   79 (220)
T cd04126          44 YNISIWDTAGR-EQFHGLGSMYCRGAAAVILTYDVSN   79 (220)
T ss_pred             EEEEEEeCCCc-ccchhhHHHHhccCCEEEEEEECCC
Confidence            56889999998 6677788889999999999999885


No 229
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=85.58  E-value=0.51  Score=45.08  Aligned_cols=19  Identities=32%  Similarity=0.583  Sum_probs=17.3

Q ss_pred             eEEEeecCCCCchhHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQM  551 (819)
                      |++++|..++|||||++.+
T Consensus         1 ki~vvG~~~~GKtsli~~~   19 (165)
T cd04146           1 KIAVLGASGVGKSALVVRF   19 (165)
T ss_pred             CEEEECCCCCcHHHHHHHH
Confidence            7999999999999999665


No 230
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=85.56  E-value=0.55  Score=42.10  Aligned_cols=25  Identities=28%  Similarity=0.400  Sum_probs=20.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      ...-+++.|+.|+||||+++.+--.
T Consensus        18 ~~~~v~i~G~~G~GKT~l~~~i~~~   42 (151)
T cd00009          18 PPKNLLLYGPPGTGKTTLARAIANE   42 (151)
T ss_pred             CCCeEEEECCCCCCHHHHHHHHHHH
Confidence            3556999999999999999988543


No 231
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=85.55  E-value=0.61  Score=39.86  Aligned_cols=21  Identities=38%  Similarity=0.493  Sum_probs=18.5

Q ss_pred             EEEeecCCCCchhHHHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKIL  554 (819)
                      +.+.|..+|||||+.+++.-.
T Consensus         2 i~i~G~~gsGKst~~~~l~~~   22 (69)
T cd02019           2 IAITGGSGSGKSTVAKKLAEQ   22 (69)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            578899999999999988755


No 232
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=85.53  E-value=0.53  Score=44.65  Aligned_cols=21  Identities=24%  Similarity=0.340  Sum_probs=18.3

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      .-.++|+|++||||||+++.+
T Consensus        15 ge~v~I~GpSGsGKSTLl~~l   35 (107)
T cd00820          15 KVGVLITGDSGIGKTELALEL   35 (107)
T ss_pred             CEEEEEEcCCCCCHHHHHHHh
Confidence            345799999999999999985


No 233
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=85.52  E-value=0.55  Score=47.12  Aligned_cols=24  Identities=21%  Similarity=0.328  Sum_probs=21.0

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ...+|++|+|.+++|||||+.++.
T Consensus         3 ~~~~KivvvGd~~vGKTsli~~~~   26 (182)
T cd04172           3 NVKCKIVVVGDSQCGKTALLHVFA   26 (182)
T ss_pred             cceEEEEEECCCCCCHHHHHHHHH
Confidence            457899999999999999999753


No 234
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=85.38  E-value=0.55  Score=48.16  Aligned_cols=26  Identities=27%  Similarity=0.377  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-|-=++
T Consensus        32 ~Ge~~~l~G~nGsGKSTLlk~l~G~~   57 (226)
T cd03234          32 SGQVMAILGSSGSGKTTLLDAISGRV   57 (226)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHhCcc
Confidence            34568999999999999999885443


No 235
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=85.37  E-value=0.5  Score=43.31  Aligned_cols=36  Identities=6%  Similarity=0.054  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+.+||++|+ ...+..|..++.+++++|||+++++
T Consensus        49 ~~~~l~D~~g~-~~~~~~~~~~~~~~d~ii~v~d~~~   84 (159)
T cd00154          49 VKLQIWDTAGQ-ERFRSITPSYYRGAHGAILVYDITN   84 (159)
T ss_pred             EEEEEEecCCh-HHHHHHHHHHhcCCCEEEEEEECCC
Confidence            68899999998 5666788999999999999999986


No 236
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=85.34  E-value=0.55  Score=47.64  Aligned_cols=26  Identities=38%  Similarity=0.439  Sum_probs=21.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~l~Gl~~   54 (216)
T TIGR00960        29 GEMVFLVGHSGAGKSTFLKLILGIEK   54 (216)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            45689999999999999998755543


No 237
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=85.33  E-value=0.55  Score=47.45  Aligned_cols=26  Identities=31%  Similarity=0.330  Sum_probs=20.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-|-=++
T Consensus        27 ~G~~~~l~G~nGsGKSTLl~~i~Gl~   52 (214)
T TIGR02673        27 KGEFLFLTGPSGAGKTTLLKLLYGAL   52 (214)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34578999999999999999775443


No 238
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=85.32  E-value=0.55  Score=43.69  Aligned_cols=18  Identities=39%  Similarity=0.613  Sum_probs=16.8

Q ss_pred             EEEeecCCCCchhHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQM  551 (819)
                      ++|.|..|+||||+++++
T Consensus         2 ~~i~G~~G~GKT~l~~~i   19 (165)
T cd01120           2 ILVFGPTGSGKTTLALQL   19 (165)
T ss_pred             eeEeCCCCCCHHHHHHHH
Confidence            689999999999999988


No 239
>PRK02496 adk adenylate kinase; Provisional
Probab=85.31  E-value=0.71  Score=45.78  Aligned_cols=25  Identities=20%  Similarity=0.288  Sum_probs=20.9

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .|++++|+.+|||||+.+.+--.|+
T Consensus         2 ~~i~i~G~pGsGKst~a~~la~~~~   26 (184)
T PRK02496          2 TRLIFLGPPGAGKGTQAVVLAEHLH   26 (184)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHhC
Confidence            5799999999999999998854443


No 240
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=85.29  E-value=1.2  Score=42.96  Aligned_cols=36  Identities=0%  Similarity=-0.069  Sum_probs=32.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..++.+++++|||+++++
T Consensus        49 ~~~~i~Dt~G~-~~~~~~~~~~~~~~~~~vlv~~~~~   84 (168)
T cd04177          49 CDLEILDTAGT-EQFTAMRELYIKSGQGFLLVYSVTS   84 (168)
T ss_pred             EEEEEEeCCCc-ccchhhhHHHHhhCCEEEEEEECCC
Confidence            68899999998 6777888889999999999999885


No 241
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form sliding c
Probab=85.27  E-value=0.65  Score=48.11  Aligned_cols=23  Identities=26%  Similarity=0.492  Sum_probs=20.5

Q ss_pred             eeEEEeecCCCCchhHHHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      -+++|.|+.+|||||++|++-++
T Consensus        30 ~~~~itGpNg~GKStlLk~i~~~   52 (213)
T cd03281          30 SIMVITGPNSSGKSVYLKQVALI   52 (213)
T ss_pred             eEEEEECCCCCChHHHHHHHHHH
Confidence            57899999999999999998753


No 242
>PRK00279 adk adenylate kinase; Reviewed
Probab=85.19  E-value=0.57  Score=47.95  Aligned_cols=25  Identities=32%  Similarity=0.436  Sum_probs=20.3

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .||+++|+.+|||||+.+++---|+
T Consensus         1 ~~I~v~G~pGsGKsT~a~~la~~~~   25 (215)
T PRK00279          1 MRLILLGPPGAGKGTQAKFIAEKYG   25 (215)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHhC
Confidence            3799999999999999887754343


No 243
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=85.18  E-value=0.62  Score=48.01  Aligned_cols=24  Identities=29%  Similarity=0.560  Sum_probs=21.4

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ..+|+|+.||||||+++.+-.+..
T Consensus        25 ~~~i~GpNGsGKStll~ai~~~l~   48 (243)
T cd03272          25 HNVVVGRNGSGKSNFFAAIRFVLS   48 (243)
T ss_pred             cEEEECCCCCCHHHHHHHHHHHHc
Confidence            678999999999999999987755


No 244
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=85.15  E-value=0.57  Score=46.71  Aligned_cols=21  Identities=19%  Similarity=0.279  Sum_probs=19.0

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|+++||..++|||||++++.
T Consensus         1 ~Ki~vlG~~~vGKTsLi~~~~   21 (182)
T cd04128           1 LKIGLLGDAQIGKTSLMVKYV   21 (182)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999998763


No 245
>PF13304 AAA_21:  AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A.
Probab=84.99  E-value=0.28  Score=47.30  Aligned_cols=21  Identities=33%  Similarity=0.706  Sum_probs=0.0

Q ss_pred             EEeecCCCCchhHHHHHHHHh
Q 003444          535 LLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       535 LLLGaGESGKSTIlKQMKILy  555 (819)
                      +|+|+.+||||||++.+.++.
T Consensus         3 viiG~N~sGKS~il~ai~~~~   23 (303)
T PF13304_consen    3 VIIGPNGSGKSNILEAIYFLF   23 (303)
T ss_dssp             ---------------------
T ss_pred             ccccccccccccccccccccc
Confidence            689999999999999998875


No 246
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.96  E-value=0.56  Score=47.42  Aligned_cols=24  Identities=25%  Similarity=0.380  Sum_probs=20.5

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .+.|+|..||||||++|-+-=++.
T Consensus        27 ~~~i~G~nGsGKSTLl~~l~Gl~~   50 (211)
T cd03264          27 MYGLLGPNGAGKTTLMRILATLTP   50 (211)
T ss_pred             cEEEECCCCCCHHHHHHHHhCCCC
Confidence            789999999999999998864443


No 247
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.88  E-value=0.6  Score=47.28  Aligned_cols=24  Identities=33%  Similarity=0.416  Sum_probs=19.9

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~G~   49 (213)
T cd03259          26 GEFLALLGPSGCGKTTLLRLIAGL   49 (213)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            446899999999999999977533


No 248
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.84  E-value=0.6  Score=47.15  Aligned_cols=25  Identities=20%  Similarity=0.244  Sum_probs=20.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        26 G~~~~i~G~nGsGKSTLl~~l~G~~   50 (210)
T cd03269          26 GEIFGLLGPNGAGKTTTIRMILGII   50 (210)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            4468899999999999999885443


No 249
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=84.83  E-value=0.58  Score=47.30  Aligned_cols=25  Identities=28%  Similarity=0.337  Sum_probs=20.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03301          26 GEFVVLLGPSGCGKTTTLRMIAGLE   50 (213)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            4458999999999999998775443


No 250
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=84.82  E-value=0.6  Score=47.81  Aligned_cols=25  Identities=28%  Similarity=0.273  Sum_probs=20.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=+.
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~Gl~   50 (232)
T cd03218          26 GEIVGLLGPNGAGKTTTFYMIVGLV   50 (232)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            4468999999999999999885443


No 251
>PLN03118 Rab family protein; Provisional
Probab=84.79  E-value=0.64  Score=46.99  Aligned_cols=22  Identities=36%  Similarity=0.511  Sum_probs=20.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..+||+++|..++|||||++++
T Consensus        13 ~~~kv~ivG~~~vGKTsli~~l   34 (211)
T PLN03118         13 LSFKILLIGDSGVGKSSLLVSF   34 (211)
T ss_pred             cceEEEEECcCCCCHHHHHHHH
Confidence            4689999999999999999986


No 252
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]
Probab=84.77  E-value=1.8  Score=45.62  Aligned_cols=24  Identities=38%  Similarity=0.623  Sum_probs=22.2

Q ss_pred             EEEeecCCCCchhHHHHHHHHhcC
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      |-++|.+|||||||++-+.+|..|
T Consensus        35 isIIGsSGSGKSTfLRCiN~LE~P   58 (256)
T COG4598          35 ISIIGSSGSGKSTFLRCINFLEKP   58 (256)
T ss_pred             EEEecCCCCchhHHHHHHHhhcCC
Confidence            567899999999999999999987


No 253
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=84.72  E-value=0.62  Score=46.26  Aligned_cols=27  Identities=30%  Similarity=0.376  Sum_probs=21.7

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.++|+|..||||||++|-+-=++.
T Consensus        24 ~G~~~~l~G~nGsGKStLl~~i~G~~~   50 (180)
T cd03214          24 AGEIVGILGPNGAGKSTLLKTLAGLLK   50 (180)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            455789999999999999998754443


No 254
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=84.67  E-value=0.62  Score=47.26  Aligned_cols=25  Identities=24%  Similarity=0.262  Sum_probs=20.7

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        31 Ge~~~i~G~nGsGKSTLl~~l~Gl~   55 (218)
T cd03266          31 GEVTGLLGPNGAGKTTTLRMLAGLL   55 (218)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCc
Confidence            4568999999999999998875444


No 255
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=84.63  E-value=0.62  Score=46.24  Aligned_cols=20  Identities=30%  Similarity=0.468  Sum_probs=18.3

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      |++++|..++|||||++++.
T Consensus         1 ki~ivG~~~vGKTsli~~l~   20 (190)
T cd04144           1 KLVVLGDGGVGKTALTIQLC   20 (190)
T ss_pred             CEEEECCCCCCHHHHHHHHH
Confidence            79999999999999998775


No 256
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=84.59  E-value=0.7  Score=46.36  Aligned_cols=22  Identities=27%  Similarity=0.366  Sum_probs=19.0

Q ss_pred             EEEeecCCCCchhHHHHHHHHh
Q 003444          534 LLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy  555 (819)
                      +.|.|..+|||||+.+.+.-+.
T Consensus         2 igi~G~~GsGKSTl~~~l~~~l   23 (198)
T cd02023           2 IGIAGGSGSGKTTVAEEIIEQL   23 (198)
T ss_pred             EEEECCCCCCHHHHHHHHHHHh
Confidence            5789999999999999996554


No 257
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=84.52  E-value=0.64  Score=46.01  Aligned_cols=26  Identities=38%  Similarity=0.424  Sum_probs=21.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=+..
T Consensus        28 Ge~~~i~G~nGsGKStLl~~l~G~~~   53 (178)
T cd03247          28 GEKIALLGRSGSGKSTLLQLLTGDLK   53 (178)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhccCC
Confidence            34688999999999999998854443


No 258
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.49  E-value=0.64  Score=47.41  Aligned_cols=25  Identities=28%  Similarity=0.352  Sum_probs=20.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~i~G~~   50 (220)
T cd03265          26 GEIFGLLGPNGAGKTTTIKMLTTLL   50 (220)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCC
Confidence            4568899999999999999875443


No 259
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=84.49  E-value=0.64  Score=47.25  Aligned_cols=24  Identities=38%  Similarity=0.447  Sum_probs=19.9

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|+.||||||++|-+-=+
T Consensus        31 G~~~~i~G~nGsGKSTLl~~i~G~   54 (221)
T TIGR02211        31 GEIVAIVGSSGSGKSTLLHLLGGL   54 (221)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            446889999999999999987433


No 260
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=84.44  E-value=0.67  Score=43.20  Aligned_cols=38  Identities=11%  Similarity=0.098  Sum_probs=32.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD  783 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYD  783 (819)
                      ..+++||.+|+ ...+..|..+|.+++++|||+|+++-+
T Consensus        49 ~~~~~~D~~g~-~~~~~~~~~~~~~~~~~i~v~d~~~~~   86 (162)
T cd04123          49 IDLAIWDTAGQ-ERYHALGPIYYRDADGAILVYDITDAD   86 (162)
T ss_pred             EEEEEEECCch-HHHHHhhHHHhccCCEEEEEEECCCHH
Confidence            57999999998 556677888899999999999998654


No 261
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=84.43  E-value=0.64  Score=47.65  Aligned_cols=27  Identities=22%  Similarity=0.274  Sum_probs=21.7

Q ss_pred             cceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      +.--.+.|+|..||||||++|-+-=++
T Consensus        24 ~~Ge~~~l~G~nGsGKSTLl~~l~G~~   50 (230)
T TIGR03410        24 PKGEVTCVLGRNGVGKTTLLKTLMGLL   50 (230)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            345678999999999999999775443


No 262
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=84.41  E-value=0.99  Score=43.74  Aligned_cols=38  Identities=5%  Similarity=-0.038  Sum_probs=32.2

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD  783 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYD  783 (819)
                      ..+++||++|+ ...+..|..++.+++++|||.|.++.+
T Consensus        49 ~~~~l~D~~g~-~~~~~~~~~~~~~~~~~i~v~d~~~~~   86 (180)
T cd04137          49 YHLEIVDTAGQ-DEYSILPQKYSIGIHGYILVYSVTSRK   86 (180)
T ss_pred             EEEEEEECCCh-HhhHHHHHHHHhhCCEEEEEEECCCHH
Confidence            56789999998 566777888999999999999999743


No 263
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=84.39  E-value=0.65  Score=47.81  Aligned_cols=25  Identities=28%  Similarity=0.226  Sum_probs=20.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~l~Gl   49 (243)
T TIGR01978        25 KGEIHAIMGPNGSGKSTLSKTIAGH   49 (243)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCC
Confidence            3457899999999999999987433


No 264
>PRK14531 adenylate kinase; Provisional
Probab=84.34  E-value=0.8  Score=45.80  Aligned_cols=25  Identities=28%  Similarity=0.348  Sum_probs=21.0

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .+|+++|+.||||||+.+++.--|+
T Consensus         3 ~~i~i~G~pGsGKsT~~~~la~~~g   27 (183)
T PRK14531          3 QRLLFLGPPGAGKGTQAARLCAAHG   27 (183)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHHhC
Confidence            4799999999999999988854554


No 265
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=84.32  E-value=2  Score=41.19  Aligned_cols=36  Identities=6%  Similarity=0.079  Sum_probs=30.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||.+|+ ...+..|..+|.+++++|+|+|+++
T Consensus        48 ~~~~i~Dt~G~-~~~~~~~~~~~~~~~~~ilv~~~~~   83 (174)
T cd04135          48 YLLGLYDTAGQ-EDYDRLRPLSYPMTDVFLICFSVVN   83 (174)
T ss_pred             EEEEEEeCCCc-ccccccccccCCCCCEEEEEEECCC
Confidence            57889999998 4556678889999999999999875


No 266
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=84.31  E-value=1.1  Score=43.26  Aligned_cols=36  Identities=3%  Similarity=0.061  Sum_probs=30.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+.+||.+|+ ...+..|.++|++++++|||+|+++
T Consensus        53 ~~~~i~Dt~G~-~~~~~~~~~~~~~~d~il~v~d~~~   88 (168)
T cd01866          53 IKLQIWDTAGQ-ESFRSITRSYYRGAAGALLVYDITR   88 (168)
T ss_pred             EEEEEEECCCc-HHHHHHHHHHhccCCEEEEEEECCC
Confidence            68999999997 4556668889999999999999884


No 267
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=84.26  E-value=0.69  Score=43.92  Aligned_cols=36  Identities=3%  Similarity=0.098  Sum_probs=31.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ......|..++.+++++|||+|+++
T Consensus        49 ~~~~~~D~~g~-~~~~~~~~~~~~~~d~~i~v~d~~~   84 (172)
T cd01862          49 VTLQIWDTAGQ-ERFQSLGVAFYRGADCCVLVYDVTN   84 (172)
T ss_pred             EEEEEEeCCCh-HHHHhHHHHHhcCCCEEEEEEECCC
Confidence            67889999998 5677789999999999999999874


No 268
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.24  E-value=0.63  Score=47.78  Aligned_cols=27  Identities=26%  Similarity=0.348  Sum_probs=21.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        30 ~Ge~~~l~G~nGsGKSTLl~~l~G~~~   56 (233)
T cd03258          30 KGEIFGIIGRSGAGKSTLIRCINGLER   56 (233)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            345788999999999999998855543


No 269
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=84.23  E-value=0.66  Score=46.98  Aligned_cols=26  Identities=35%  Similarity=0.399  Sum_probs=20.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        24 ~Ge~~~l~G~nGsGKSTLl~~l~G~~   49 (213)
T cd03235          24 PGEFLAIVGPNGAGKSTLLKAILGLL   49 (213)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHcCCC
Confidence            34568999999999999999774333


No 270
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=84.23  E-value=0.65  Score=47.86  Aligned_cols=26  Identities=27%  Similarity=0.399  Sum_probs=21.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        27 ~Ge~~~l~G~nGsGKSTLl~~l~Gl~   52 (243)
T TIGR02315        27 PGEFVAIIGPSGAGKSTLLRCINRLV   52 (243)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCc
Confidence            34578999999999999998775444


No 271
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=84.22  E-value=0.67  Score=44.55  Aligned_cols=36  Identities=8%  Similarity=0.097  Sum_probs=31.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ......|.+++.+++++|||.|+++
T Consensus        52 ~~l~l~D~~g~-~~~~~~~~~~~~~ad~~i~v~d~~~   87 (167)
T cd01867          52 IKLQIWDTAGQ-ERFRTITTAYYRGAMGIILVYDITD   87 (167)
T ss_pred             EEEEEEeCCch-HHHHHHHHHHhCCCCEEEEEEECcC
Confidence            68999999998 5667778899999999999999874


No 272
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=84.21  E-value=0.66  Score=47.08  Aligned_cols=26  Identities=27%  Similarity=0.392  Sum_probs=21.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~l~Gl~   50 (222)
T cd03224          25 EGEIVALLGRNGAGKTTLLKTIMGLL   50 (222)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHhCCC
Confidence            34578999999999999999775443


No 273
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=84.20  E-value=0.69  Score=43.97  Aligned_cols=20  Identities=20%  Similarity=0.488  Sum_probs=18.4

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      +|+|+|..++|||||++++.
T Consensus         2 ~i~~~G~~~~GKssli~~l~   21 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKLT   21 (168)
T ss_pred             eEEEEcCCCCCHHHHHHHHh
Confidence            78999999999999999863


No 274
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=84.17  E-value=0.7  Score=46.65  Aligned_cols=21  Identities=24%  Similarity=0.487  Sum_probs=19.5

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +|+.++|.+++||||+++.+.
T Consensus         2 ~kI~i~G~~g~GKSSLin~L~   22 (197)
T cd04104           2 LNIAVTGESGAGKSSFINALR   22 (197)
T ss_pred             eEEEEECCCCCCHHHHHHHHh
Confidence            689999999999999999874


No 275
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=84.16  E-value=0.68  Score=46.47  Aligned_cols=26  Identities=35%  Similarity=0.456  Sum_probs=21.3

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        24 Ge~~~i~G~nGsGKSTLl~~l~G~~~   49 (206)
T TIGR03608        24 GKMYAIIGESGSGKSTLLNIIGLLEK   49 (206)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcCCC
Confidence            44689999999999999998865544


No 276
>PRK05480 uridine/cytidine kinase; Provisional
Probab=84.14  E-value=0.72  Score=46.73  Aligned_cols=25  Identities=24%  Similarity=0.187  Sum_probs=21.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      +...|.|.|.++|||||+.+.+.-.
T Consensus         5 ~~~iI~I~G~sGsGKTTl~~~l~~~   29 (209)
T PRK05480          5 KPIIIGIAGGSGSGKTTVASTIYEE   29 (209)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHH
Confidence            4567899999999999999987543


No 277
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=84.10  E-value=0.64  Score=47.72  Aligned_cols=24  Identities=21%  Similarity=0.288  Sum_probs=19.9

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHh
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      -.+.|+|..||||||++|-+-=++
T Consensus        14 e~~~l~G~NGsGKSTLlk~i~Gl~   37 (213)
T PRK15177         14 EHIGILAAPGSGKTTLTRLLCGLD   37 (213)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCc
Confidence            467899999999999999876443


No 278
>PF04670 Gtr1_RagA:  Gtr1/RagA G protein conserved region;  InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1. RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
Probab=84.10  E-value=2.1  Score=45.55  Aligned_cols=36  Identities=19%  Similarity=0.427  Sum_probs=27.0

Q ss_pred             ccEEEEEecccc-cccc---cccccccCCCCEEEEEEeCC
Q 003444          745 LRYQLIRVQARG-LGEN---CKWLEMFEDIGMVIFCVALS  780 (819)
Q Consensus       745 l~frLiDVGGQg-rsER---kKWi~~FEdVtaVIFvVSLS  780 (819)
                      +.+++||.|||. .-+.   ....+.|.+|.++|||+|..
T Consensus        48 ~~l~iwD~pGq~~~~~~~~~~~~~~if~~v~~LIyV~D~q   87 (232)
T PF04670_consen   48 LPLNIWDCPGQDDFMENYFNSQREEIFSNVGVLIYVFDAQ   87 (232)
T ss_dssp             CEEEEEEE-SSCSTTHTTHTCCHHHHHCTESEEEEEEETT
T ss_pred             cEEEEEEcCCccccccccccccHHHHHhccCEEEEEEEcc
Confidence            789999999993 1121   23455799999999999988


No 279
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=84.07  E-value=0.67  Score=47.70  Aligned_cols=26  Identities=35%  Similarity=0.455  Sum_probs=21.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G~~~   51 (235)
T cd03261          26 GEILAIIGPSGSGKSTLLRLIVGLLR   51 (235)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            34689999999999999998864443


No 280
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=84.00  E-value=0.93  Score=44.63  Aligned_cols=37  Identities=11%  Similarity=0.111  Sum_probs=31.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+ ...+..|..+|.+++++|||+|+++.
T Consensus        50 ~~l~i~D~~G~-~~~~~~~~~~~~~~d~iilv~d~~~~   86 (193)
T cd04118          50 VTLGIWDTAGS-ERYEAMSRIYYRGAKAAIVCYDLTDS   86 (193)
T ss_pred             EEEEEEECCCc-hhhhhhhHhhcCCCCEEEEEEECCCH
Confidence            67889999998 56667788889999999999999864


No 281
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=83.95  E-value=0.68  Score=48.52  Aligned_cols=28  Identities=29%  Similarity=0.310  Sum_probs=22.6

Q ss_pred             cceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +.--.+.|+|..||||||++|-+-=++.
T Consensus        30 ~~Ge~~~i~G~nGsGKSTLl~~l~Gl~~   57 (258)
T PRK11701         30 YPGEVLGIVGESGSGKTTLLNALSARLA   57 (258)
T ss_pred             eCCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            3456789999999999999998865543


No 282
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=83.92  E-value=0.7  Score=47.18  Aligned_cols=26  Identities=27%  Similarity=0.416  Sum_probs=21.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-|-=++.
T Consensus        37 Ge~~~i~G~nGsGKSTLl~~i~G~~~   62 (214)
T PRK13543         37 GEALLVQGDNGAGKTTLLRVLAGLLH   62 (214)
T ss_pred             CCEEEEEcCCCCCHHHHHHHHhCCCC
Confidence            45689999999999999998865544


No 283
>PLN03110 Rab GTPase; Provisional
Probab=83.91  E-value=0.74  Score=47.12  Aligned_cols=22  Identities=41%  Similarity=0.611  Sum_probs=20.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..+||+++|..++|||||+.++
T Consensus        11 ~~~Ki~ivG~~~vGKStLi~~l   32 (216)
T PLN03110         11 YLFKIVLIGDSGVGKSNILSRF   32 (216)
T ss_pred             ceeEEEEECCCCCCHHHHHHHH
Confidence            4689999999999999999876


No 284
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=83.83  E-value=0.51  Score=48.31  Aligned_cols=24  Identities=38%  Similarity=0.643  Sum_probs=20.9

Q ss_pred             eEEEeecCCCCchhHHHHHH-HHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAK-ILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK-ILy~  556 (819)
                      .+.|+|+.|||||||+|-+. .||+
T Consensus        30 ~~~i~G~NGsGKSTll~~i~~~l~g   54 (213)
T cd03279          30 LFLICGPTGAGKSTILDAITYALYG   54 (213)
T ss_pred             EEEEECCCCCCHHHHHHHheeeEec
Confidence            57899999999999999998 4665


No 285
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=83.77  E-value=0.71  Score=47.00  Aligned_cols=37  Identities=5%  Similarity=-0.022  Sum_probs=31.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      ..+++||++|+ ...+..|..+|.++++||||+|+++-
T Consensus        50 ~~~~i~Dt~G~-~~~~~l~~~~~~~ad~iilV~D~t~~   86 (215)
T cd04109          50 VTLQVWDIGGQ-SIGGKMLDKYIYGAHAVFLVYDVTNS   86 (215)
T ss_pred             EEEEEEECCCc-HHHHHHHHHHhhcCCEEEEEEECCCH
Confidence            68999999998 55667788899999999999999863


No 286
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=83.75  E-value=0.72  Score=46.55  Aligned_cols=25  Identities=36%  Similarity=0.475  Sum_probs=20.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-|-=++
T Consensus        27 G~~~~l~G~nGsGKSTLl~~l~G~~   51 (211)
T cd03225          27 GEFVLIVGPNGSGKSTLLRLLNGLL   51 (211)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcCC
Confidence            4468899999999999999775443


No 287
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=83.71  E-value=1.2  Score=45.63  Aligned_cols=36  Identities=8%  Similarity=0.099  Sum_probs=31.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+..|..++.+++++|||.|+++
T Consensus        52 ~~l~i~Dt~G~-~~~~~~~~~~~~~~d~iilv~D~~~   87 (211)
T cd04111          52 IKLQLWDTAGQ-ERFRSITRSYYRNSVGVLLVFDITN   87 (211)
T ss_pred             EEEEEEeCCcc-hhHHHHHHHHhcCCcEEEEEEECCC
Confidence            68999999998 5666778889999999999999885


No 288
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=83.68  E-value=0.69  Score=48.96  Aligned_cols=21  Identities=19%  Similarity=0.422  Sum_probs=19.3

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||++||.+++|||||++++.
T Consensus         1 ~KVvvlG~~gvGKTSLi~r~~   21 (247)
T cd04143           1 YRMVVLGASKVGKTAIVSRFL   21 (247)
T ss_pred             CEEEEECcCCCCHHHHHHHHH
Confidence            589999999999999999874


No 289
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=83.66  E-value=0.7  Score=46.06  Aligned_cols=25  Identities=32%  Similarity=0.553  Sum_probs=20.2

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      -.+.|+|..||||||++|-+-=++.
T Consensus        19 e~~~i~G~nGsGKSTLl~~i~G~~~   43 (190)
T TIGR01166        19 EVLALLGANGAGKSTLLLHLNGLLR   43 (190)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCC
Confidence            3578999999999999987754443


No 290
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.65  E-value=0.68  Score=47.57  Aligned_cols=26  Identities=31%  Similarity=0.396  Sum_probs=21.3

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~Gl~~   52 (241)
T cd03256          27 GEFVALIGPSGAGKSTLLRCLNGLVE   52 (241)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCcC
Confidence            45689999999999999998864443


No 291
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=83.64  E-value=0.72  Score=47.52  Aligned_cols=24  Identities=38%  Similarity=0.470  Sum_probs=20.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|+.||||||++|-+-=+
T Consensus        35 Ge~~~l~G~nGsGKSTLl~~l~Gl   58 (233)
T PRK11629         35 GEMMAIVGSSGSGKSTLLHLLGGL   58 (233)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcC
Confidence            346899999999999999987533


No 292
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=83.64  E-value=0.73  Score=46.46  Aligned_cols=27  Identities=30%  Similarity=0.359  Sum_probs=21.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +--.+.|+|..||||||++|-+-=++.
T Consensus        26 ~Ge~~~l~G~nGsGKSTLl~~i~G~~~   52 (200)
T PRK13540         26 AGGLLHLKGSNGAGKTTLLKLIAGLLN   52 (200)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            456789999999999999997754443


No 293
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=83.63  E-value=0.69  Score=46.97  Aligned_cols=26  Identities=23%  Similarity=0.272  Sum_probs=21.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        28 Ge~~~i~G~nGsGKSTLl~~l~Gl~~   53 (220)
T cd03263          28 GEIFGLLGHNGAGKTTTLKMLTGELR   53 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCCC
Confidence            34688999999999999998864443


No 294
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=83.62  E-value=0.77  Score=45.70  Aligned_cols=21  Identities=19%  Similarity=0.366  Sum_probs=19.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+|+|.+++|||+|+.++.
T Consensus         2 ~Kiv~vG~~~vGKTsli~~~~   22 (178)
T cd04131           2 CKIVVVGDVQCGKTALLQVFA   22 (178)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            699999999999999998863


No 295
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=83.60  E-value=0.75  Score=43.52  Aligned_cols=37  Identities=3%  Similarity=0.047  Sum_probs=32.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      ..+++||++|+ ...+..|.+++.+++++|||+|+++.
T Consensus        49 ~~l~l~D~~G~-~~~~~~~~~~~~~~~~~i~v~d~~~~   85 (161)
T cd04113          49 VKLQIWDTAGQ-ERFRSVTRSYYRGAAGALLVYDITNR   85 (161)
T ss_pred             EEEEEEECcch-HHHHHhHHHHhcCCCEEEEEEECCCH
Confidence            68899999998 55566788899999999999999874


No 296
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=83.59  E-value=0.74  Score=44.73  Aligned_cols=19  Identities=21%  Similarity=0.665  Sum_probs=17.7

Q ss_pred             EEEeecCCCCchhHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMK  552 (819)
                      |+|+|.+++|||||++++.
T Consensus         2 i~ivG~~~vGKTsli~~~~   20 (164)
T cd04162           2 ILVLGLDGAGKTSLLHSLS   20 (164)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            7999999999999999875


No 297
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=83.59  E-value=0.73  Score=43.77  Aligned_cols=20  Identities=30%  Similarity=0.463  Sum_probs=18.1

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      .+.++|..++|||||++.+.
T Consensus         2 ~v~ivG~~~~GKStl~~~l~   21 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSAIS   21 (170)
T ss_pred             CeEEECCCCCCHHHHHHHHh
Confidence            47899999999999999985


No 298
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=83.58  E-value=1.5  Score=41.91  Aligned_cols=38  Identities=3%  Similarity=0.089  Sum_probs=30.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+.+.....|..++.+++++|||.|+++-
T Consensus        47 ~~~~i~D~~g~~~~~~~~~~~~~~~~d~~i~v~d~~~~   84 (165)
T cd04146          47 VSLEILDTAGQQQADTEQLERSIRWADGFVLVYSITDR   84 (165)
T ss_pred             EEEEEEECCCCcccccchHHHHHHhCCEEEEEEECCCH
Confidence            67999999998222344577788999999999999864


No 299
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=83.56  E-value=1.3  Score=41.73  Aligned_cols=36  Identities=11%  Similarity=0.133  Sum_probs=31.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..++.+++++|||+|+++
T Consensus        49 ~~l~~~D~~G~-~~~~~~~~~~~~~~~~ii~v~d~~~   84 (161)
T cd01861          49 VRLQLWDTAGQ-ERFRSLIPSYIRDSSVAVVVYDITN   84 (161)
T ss_pred             EEEEEEECCCc-HHHHHHHHHHhccCCEEEEEEECcC
Confidence            57999999998 5667778889999999999999985


No 300
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.54  E-value=0.7  Score=47.10  Aligned_cols=25  Identities=36%  Similarity=0.361  Sum_probs=20.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        30 G~~~~i~G~nGsGKSTLl~~l~Gl~   54 (220)
T cd03293          30 GEFVALVGPSGCGKSTLLRIIAGLE   54 (220)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            4468899999999999999875443


No 301
>PRK04213 GTP-binding protein; Provisional
Probab=83.54  E-value=0.73  Score=45.77  Aligned_cols=23  Identities=26%  Similarity=0.469  Sum_probs=20.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ...|++++|..++|||||++.+.
T Consensus         8 ~~~~i~i~G~~~~GKSsLin~l~   30 (201)
T PRK04213          8 RKPEIVFVGRSNVGKSTLVRELT   30 (201)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHh
Confidence            46899999999999999999873


No 302
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=83.52  E-value=0.74  Score=44.47  Aligned_cols=22  Identities=36%  Similarity=0.611  Sum_probs=15.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .-=+||.|..|+||||+++.+.
T Consensus        24 ~~~~ll~G~~G~GKT~ll~~~~   45 (185)
T PF13191_consen   24 PRNLLLTGESGSGKTSLLRALL   45 (185)
T ss_dssp             ---EEE-B-TTSSHHHHHHHHH
T ss_pred             CcEEEEECCCCCCHHHHHHHHH
Confidence            3457889999999999999764


No 303
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=83.51  E-value=0.73  Score=47.80  Aligned_cols=26  Identities=27%  Similarity=0.470  Sum_probs=20.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        28 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   53 (250)
T PRK11264         28 PGEVVAIIGPSGSGKTTLLRCINLLE   53 (250)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCC
Confidence            34568999999999999999775443


No 304
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=83.51  E-value=0.73  Score=47.98  Aligned_cols=23  Identities=35%  Similarity=0.426  Sum_probs=19.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .--.+.|+|..||||||++|-+-
T Consensus        31 ~Ge~~~i~G~nGsGKSTLl~~l~   53 (253)
T PRK14242         31 QNQVTALIGPSGCGKSTFLRCLN   53 (253)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHH
Confidence            34568999999999999999885


No 305
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.47  E-value=0.76  Score=46.22  Aligned_cols=23  Identities=26%  Similarity=0.336  Sum_probs=19.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .--.+.|+|..||||||++|-+-
T Consensus        32 ~Ge~~~l~G~nGsGKSTLl~~l~   54 (192)
T cd03232          32 PGTLTALMGESGAGKTTLLDVLA   54 (192)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHh
Confidence            34578899999999999999775


No 306
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=83.41  E-value=0.74  Score=46.81  Aligned_cols=27  Identities=44%  Similarity=0.412  Sum_probs=21.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        30 ~Ge~~~i~G~nGsGKSTLl~~l~G~~~   56 (228)
T cd03257          30 KGETLGLVGESGSGKSTLARAILGLLK   56 (228)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            345789999999999999998754443


No 307
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=83.41  E-value=0.73  Score=45.72  Aligned_cols=27  Identities=33%  Similarity=0.372  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        25 ~G~~~~i~G~nGsGKSTLl~~l~G~~~   51 (178)
T cd03229          25 AGEIVALLGPSGSGKSTLLRCIAGLEE   51 (178)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            345678999999999999998754433


No 308
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=83.39  E-value=0.75  Score=47.35  Aligned_cols=25  Identities=36%  Similarity=0.383  Sum_probs=20.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~Gl   51 (237)
T cd03252          27 PGEVVGIVGRSGSGKSTLTKLIQRF   51 (237)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcC
Confidence            4557899999999999999987533


No 309
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]
Probab=83.34  E-value=0.93  Score=52.16  Aligned_cols=42  Identities=29%  Similarity=0.453  Sum_probs=34.4

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhcC---------CCCCHHHhhhhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYKA---------VPFSDDEHENIKLKIQ  573 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~p---------~GFS~eEr~~~K~iIq  573 (819)
                      ==+.|+|..||||||++|-+-=||+|         ++.+.+.++.||..+-
T Consensus       350 elvFliG~NGsGKST~~~LLtGL~~PqsG~I~ldg~pV~~e~ledYR~LfS  400 (546)
T COG4615         350 ELVFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSAEQLEDYRKLFS  400 (546)
T ss_pred             cEEEEECCCCCcHHHHHHHHhcccCCCCCceeECCccCCCCCHHHHHHHHH
Confidence            34688999999999999999888877         5578888888986543


No 310
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=83.31  E-value=0.71  Score=46.80  Aligned_cols=27  Identities=22%  Similarity=0.176  Sum_probs=21.3

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|+.||||||++|-+-=+..
T Consensus        24 ~Ge~~~l~G~nGsGKSTLl~~l~Gl~~   50 (177)
T cd03222          24 EGEVIGIVGPNGTGKTTAVKILAGQLI   50 (177)
T ss_pred             CCCEEEEECCCCChHHHHHHHHHcCCC
Confidence            345788999999999999997754443


No 311
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=83.26  E-value=0.7  Score=50.01  Aligned_cols=24  Identities=38%  Similarity=0.425  Sum_probs=19.2

Q ss_pred             EEEeecCCCCchhHHHHHHHHhcC
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +-|||+.||||||++|-+-=+..|
T Consensus        31 ~~iiGpNG~GKSTLLk~l~g~l~p   54 (258)
T COG1120          31 TGILGPNGSGKSTLLKCLAGLLKP   54 (258)
T ss_pred             EEEECCCCCCHHHHHHHHhccCCC
Confidence            468999999999999988544443


No 312
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=83.22  E-value=1.9  Score=41.97  Aligned_cols=55  Identities=7%  Similarity=0.070  Sum_probs=36.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIRWN  817 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~t~  817 (819)
                      ..+++||++|| ..     ..++.+++++|+|.|+++            .+.+++...+++.+.++.-..+.|
T Consensus        47 ~~l~i~D~~g~-~~-----~~~~~~~~~~ilv~d~~~------------~~sf~~~~~~~~~i~~~~~~~~~p  101 (158)
T cd04103          47 HLLLIRDEGGA-PD-----AQFASWVDAVIFVFSLEN------------EASFQTVYNLYHQLSSYRNISEIP  101 (158)
T ss_pred             EEEEEEECCCC-Cc-----hhHHhcCCEEEEEEECCC------------HHHHHHHHHHHHHHHHhcCCCCCC
Confidence            67899999998 21     246788999999999985            244555555555555443333333


No 313
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=83.14  E-value=0.77  Score=47.27  Aligned_cols=26  Identities=23%  Similarity=0.391  Sum_probs=21.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        25 Ge~~~l~G~nGsGKSTLl~~l~Gl~~   50 (232)
T PRK10771         25 GERVAILGPSGAGKSTLLNLIAGFLT   50 (232)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            45788999999999999998754443


No 314
>PLN00023 GTP-binding protein; Provisional
Probab=83.12  E-value=0.93  Score=50.76  Aligned_cols=36  Identities=22%  Similarity=0.147  Sum_probs=33.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.++|||++|| ...+.-|..+|.+++++|+|.|+++
T Consensus        83 v~LqIWDTAGq-ErfrsL~~~yyr~AdgiILVyDITd  118 (334)
T PLN00023         83 FFVELWDVSGH-ERYKDCRSLFYSQINGVIFVHDLSQ  118 (334)
T ss_pred             EEEEEEECCCC-hhhhhhhHHhccCCCEEEEEEeCCC
Confidence            67899999998 6778889999999999999999986


No 315
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=83.10  E-value=0.8  Score=46.04  Aligned_cols=27  Identities=22%  Similarity=0.345  Sum_probs=21.5

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~l~G~~~   51 (198)
T TIGR01189        25 AGEALQVTGPNGIGKTTLLRILAGLLR   51 (198)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCCC
Confidence            355789999999999999997754443


No 316
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=83.06  E-value=0.79  Score=46.87  Aligned_cols=26  Identities=31%  Similarity=0.378  Sum_probs=21.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~i~G~~   50 (227)
T cd03260          25 KGEITALIGPSGCGKSTLLRLLNRLN   50 (227)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHhhc
Confidence            34578899999999999999875444


No 317
>PLN03118 Rab family protein; Provisional
Probab=83.05  E-value=0.84  Score=46.15  Aligned_cols=36  Identities=6%  Similarity=0.064  Sum_probs=32.1

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+.|||++|+ ...+..|..+|.+++++|||+|+++
T Consensus        62 ~~l~l~Dt~G~-~~~~~~~~~~~~~~d~~vlv~D~~~   97 (211)
T PLN03118         62 LKLTIWDTAGQ-ERFRTLTSSYYRNAQGIILVYDVTR   97 (211)
T ss_pred             EEEEEEECCCc-hhhHHHHHHHHhcCCEEEEEEECCC
Confidence            67899999998 6667778889999999999999986


No 318
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=83.01  E-value=0.77  Score=47.36  Aligned_cols=21  Identities=24%  Similarity=0.531  Sum_probs=19.3

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+|+|..++|||||+.++.
T Consensus         1 ~KI~lvG~~gvGKTsLi~~~~   21 (221)
T cd04148           1 YRVVMLGSPGVGKSSLASQFT   21 (221)
T ss_pred             CEEEEECCCCCcHHHHHHHHh
Confidence            589999999999999999873


No 319
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=83.00  E-value=0.79  Score=47.24  Aligned_cols=21  Identities=33%  Similarity=0.510  Sum_probs=19.0

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+|+|.+++|||+|++++.
T Consensus         1 vKIvlvGd~gVGKTSLi~~~~   21 (202)
T cd04102           1 VRVLVVGDSGVGKSSLVHLIC   21 (202)
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            699999999999999998753


No 320
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.95  E-value=0.76  Score=46.64  Aligned_cols=24  Identities=29%  Similarity=0.367  Sum_probs=20.5

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHh
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      -.+.|+|..||||||++|-+-=++
T Consensus        24 e~~~i~G~nGsGKSTLl~~l~G~~   47 (214)
T cd03297          24 EVTGIFGASGAGKSTLLRCIAGLE   47 (214)
T ss_pred             eeEEEECCCCCCHHHHHHHHhCCC
Confidence            678999999999999999875444


No 321
>PF13479 AAA_24:  AAA domain
Probab=82.93  E-value=0.7  Score=47.58  Aligned_cols=23  Identities=30%  Similarity=0.476  Sum_probs=21.3

Q ss_pred             cceeeEEEeecCCCCchhHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ++.+|+||.|.+|+||||+.+.+
T Consensus         1 ~~~~~~lIyG~~G~GKTt~a~~~   23 (213)
T PF13479_consen    1 KKPIKILIYGPPGSGKTTLAASL   23 (213)
T ss_pred             CCceEEEEECCCCCCHHHHHHhC
Confidence            45789999999999999999999


No 322
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=82.92  E-value=0.79  Score=47.22  Aligned_cols=26  Identities=35%  Similarity=0.531  Sum_probs=21.4

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        28 ~Ge~~~l~G~nGsGKSTLl~~i~G~~   53 (238)
T cd03249          28 PGKTVALVGSSGCGKSTVVSLLERFY   53 (238)
T ss_pred             CCCEEEEEeCCCCCHHHHHHHHhccC
Confidence            34578999999999999999876444


No 323
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional
Probab=82.89  E-value=1.2  Score=52.09  Aligned_cols=31  Identities=35%  Similarity=0.403  Sum_probs=26.2

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +-++--|++++|..||||||++|-+-=+|.|
T Consensus       365 ~i~~G~~~aIvG~sGsGKSTLl~ll~gl~~p  395 (582)
T PRK11176        365 KIPAGKTVALVGRSGSGKSTIANLLTRFYDI  395 (582)
T ss_pred             EeCCCCEEEEECCCCCCHHHHHHHHHhccCC
Confidence            3445778999999999999999999777765


No 324
>PRK05057 aroK shikimate kinase I; Reviewed
Probab=82.87  E-value=0.82  Score=45.64  Aligned_cols=22  Identities=41%  Similarity=0.552  Sum_probs=19.4

Q ss_pred             eeEEEeecCCCCchhHHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKI  553 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKI  553 (819)
                      .+|+|+|..+|||||+.+.+--
T Consensus         5 ~~I~liG~~GaGKStl~~~La~   26 (172)
T PRK05057          5 RNIFLVGPMGAGKSTIGRQLAQ   26 (172)
T ss_pred             CEEEEECCCCcCHHHHHHHHHH
Confidence            4699999999999999999853


No 325
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.86  E-value=0.83  Score=45.09  Aligned_cols=25  Identities=28%  Similarity=0.283  Sum_probs=20.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+==++
T Consensus        26 Ge~~~i~G~nGsGKStLl~~l~G~~   50 (173)
T cd03230          26 GEIYGLLGPNGAGKTTLIKIILGLL   50 (173)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            4568899999999999999774443


No 326
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis of aromatic compounds, such as aromatic amino acids, p-aminobenzoic acid, folate and ubiquinone. Shikimate kinase catalyses the phosphorylation of the 3-hydroxyl group of shikimic acid using ATP.
Probab=82.80  E-value=0.88  Score=43.05  Aligned_cols=23  Identities=22%  Similarity=0.398  Sum_probs=19.6

Q ss_pred             EEEeecCCCCchhHHHHHHHHhc
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~  556 (819)
                      |+|.|..+|||||+.|.+.-.++
T Consensus         2 i~l~G~~GsGKstla~~la~~l~   24 (154)
T cd00464           2 IVLIGMMGAGKTTVGRLLAKALG   24 (154)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHhC
Confidence            78999999999999999874444


No 327
>PRK00131 aroK shikimate kinase; Reviewed
Probab=82.78  E-value=0.83  Score=43.85  Aligned_cols=26  Identities=27%  Similarity=0.313  Sum_probs=20.7

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ...|+|.|..||||||+.|.+.-..+
T Consensus         4 ~~~i~l~G~~GsGKstla~~La~~l~   29 (175)
T PRK00131          4 GPNIVLIGFMGAGKSTIGRLLAKRLG   29 (175)
T ss_pred             CCeEEEEcCCCCCHHHHHHHHHHHhC
Confidence            34689999999999999998754433


No 328
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=82.78  E-value=0.77  Score=47.29  Aligned_cols=26  Identities=38%  Similarity=0.262  Sum_probs=20.9

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        12 Ge~~~i~G~nGsGKSTLl~~l~Gl~~   37 (230)
T TIGR02770        12 GEVLALVGESGSGKSLTCLAILGLLP   37 (230)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            34678999999999999998754443


No 329
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.77  E-value=0.82  Score=46.71  Aligned_cols=25  Identities=24%  Similarity=0.473  Sum_probs=20.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|+.||||||++|-+-=+.
T Consensus        29 G~~~~i~G~nGsGKSTLl~~l~G~~   53 (229)
T cd03254          29 GETVAIVGPTGAGKTTLINLLMRFY   53 (229)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCc
Confidence            4468999999999999999885443


No 330
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=82.74  E-value=0.67  Score=50.91  Aligned_cols=29  Identities=28%  Similarity=0.370  Sum_probs=23.8

Q ss_pred             hHHHhcceeeEEEeecCCCCchhHHHHHH
Q 003444          524 DYIERRTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       524 dk~~~k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ...+.+...-|=|+|..||||||+++.+-
T Consensus        97 ~~~~~~~~~~v~l~G~pGsGKTTLl~~l~  125 (290)
T PRK10463         97 ARFAARKQLVLNLVSSPGSGKTTLLTETL  125 (290)
T ss_pred             HHHHhcCCeEEEEECCCCCCHHHHHHHHH
Confidence            34566777888899999999999998763


No 331
>PHA02530 pseT polynucleotide kinase; Provisional
Probab=82.73  E-value=0.77  Score=48.83  Aligned_cols=22  Identities=36%  Similarity=0.446  Sum_probs=18.0

Q ss_pred             EEEeecCCCCchhHHHHHHHHh
Q 003444          534 LLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy  555 (819)
                      ++|.|..||||||+.|++.--+
T Consensus         5 iil~G~pGSGKSTla~~L~~~~   26 (300)
T PHA02530          5 ILTVGVPGSGKSTWAREFAAKN   26 (300)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHC
Confidence            5677999999999999975433


No 332
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=82.71  E-value=0.78  Score=45.93  Aligned_cols=19  Identities=21%  Similarity=0.688  Sum_probs=17.8

Q ss_pred             eEEEeecCCCCchhHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQM  551 (819)
                      ||+++|..++||||++.++
T Consensus         1 kv~vvG~~~vGKTsll~~~   19 (198)
T cd04147           1 RLVFMGAAGVGKTALIQRF   19 (198)
T ss_pred             CEEEECCCCCCHHHHHHHH
Confidence            7999999999999999976


No 333
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=82.70  E-value=1  Score=44.01  Aligned_cols=36  Identities=11%  Similarity=0.254  Sum_probs=31.3

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+..|..+|.++++||||.|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~ad~ii~v~d~~~   84 (187)
T cd04132          49 IELALWDTAGQ-EEYDRLRPLSYPDVDVLLICYAVDN   84 (187)
T ss_pred             EEEEEEECCCc-hhHHHHHHHhCCCCCEEEEEEECCC
Confidence            68899999998 5556678889999999999999985


No 334
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=82.70  E-value=0.84  Score=45.43  Aligned_cols=26  Identities=15%  Similarity=0.120  Sum_probs=21.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        26 G~~~~i~G~nGsGKSTLl~~l~G~~~   51 (182)
T cd03215          26 GEIVGIAGLVGNGQTELAEALFGLRP   51 (182)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCCC
Confidence            45689999999999999998754443


No 335
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=82.69  E-value=1.2  Score=41.75  Aligned_cols=36  Identities=22%  Similarity=0.172  Sum_probs=28.9

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||..|+ ...+..+..++.++++||||+|.++
T Consensus        51 ~~~~~~DtpG~-~~~~~~~~~~~~~ad~ii~V~d~~~   86 (164)
T cd04171          51 KRLGFIDVPGH-EKFIKNMLAGAGGIDLVLLVVAADE   86 (164)
T ss_pred             cEEEEEECCCh-HHHHHHHHhhhhcCCEEEEEEECCC
Confidence            47899999998 4444555667889999999999875


No 336
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=82.67  E-value=0.86  Score=44.96  Aligned_cols=26  Identities=35%  Similarity=0.623  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        26 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   51 (166)
T cd03223          26 PGDRLLITGPSGTGKSSLFRALAGLW   51 (166)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCC
Confidence            34578999999999999999875443


No 337
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=82.64  E-value=0.7  Score=44.30  Aligned_cols=18  Identities=22%  Similarity=0.421  Sum_probs=16.3

Q ss_pred             EEEeecCCCCchhHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQM  551 (819)
                      ++++|..++|||||++++
T Consensus         1 i~i~G~~~vGKTsli~~~   18 (174)
T smart00174        1 LVVVGDGAVGKTCLLISY   18 (174)
T ss_pred             CEEECCCCCCHHHHHHHH
Confidence            589999999999999965


No 338
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=82.62  E-value=0.79  Score=47.60  Aligned_cols=25  Identities=20%  Similarity=0.309  Sum_probs=20.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--++|.|..|+||||++|++--..
T Consensus        43 ~~~~~l~G~~G~GKTtl~~~l~~~l   67 (269)
T TIGR03015        43 EGFILITGEVGAGKTTLIRNLLKRL   67 (269)
T ss_pred             CCEEEEEcCCCCCHHHHHHHHHHhc
Confidence            4468999999999999999875443


No 339
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=82.62  E-value=0.8  Score=46.86  Aligned_cols=26  Identities=35%  Similarity=0.388  Sum_probs=21.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        36 Ge~~~i~G~nGsGKSTLl~~i~Gl~~   61 (228)
T PRK10584         36 GETIALIGESGSGKSTLLAILAGLDD   61 (228)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHcCCC
Confidence            45789999999999999998865543


No 340
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=82.62  E-value=0.83  Score=47.40  Aligned_cols=26  Identities=23%  Similarity=0.280  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        46 ~Ge~~~i~G~NGsGKSTLl~~i~Gl~   71 (236)
T cd03267          46 KGEIVGFIGPNGAGKTTTLKILSGLL   71 (236)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCc
Confidence            34678999999999999999875443


No 341
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.61  E-value=0.84  Score=46.87  Aligned_cols=27  Identities=41%  Similarity=0.545  Sum_probs=21.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|+.||||||++|-+-=++.
T Consensus        26 ~Ge~~~l~G~nGsGKSTLl~~i~Gl~~   52 (236)
T cd03253          26 AGKKVAIVGPSGSGKSTILRLLFRFYD   52 (236)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcccC
Confidence            345789999999999999998865543


No 342
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=82.60  E-value=0.81  Score=46.05  Aligned_cols=24  Identities=38%  Similarity=0.574  Sum_probs=19.5

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      -++|+|..||||||+++.+--+..
T Consensus         5 ~i~l~G~sGsGKSTl~~~la~~l~   28 (176)
T PRK09825          5 SYILMGVSGSGKSLIGSKIAALFS   28 (176)
T ss_pred             EEEEECCCCCCHHHHHHHHHHhcC
Confidence            368999999999999998754443


No 343
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism]
Probab=82.60  E-value=2  Score=44.79  Aligned_cols=27  Identities=30%  Similarity=0.357  Sum_probs=20.7

Q ss_pred             HHHhcceeeEEEeecCCCCchhHHHHH
Q 003444          525 YIERRTLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       525 k~~~k~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ++...+-.-|-+-|-++||||||.--+
T Consensus        17 ~~~~~~~~viW~TGLSGsGKSTiA~al   43 (197)
T COG0529          17 ALKGQKGAVIWFTGLSGSGKSTIANAL   43 (197)
T ss_pred             HHhCCCCeEEEeecCCCCCHHHHHHHH
Confidence            444445567888999999999997655


No 344
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=82.60  E-value=0.84  Score=47.20  Aligned_cols=27  Identities=22%  Similarity=0.261  Sum_probs=21.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=+..
T Consensus        28 ~Ge~~~l~G~nGsGKSTLl~~l~G~~~   54 (241)
T PRK10895         28 SGEIVGLLGPNGAGKTTTFYMVVGIVP   54 (241)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCCC
Confidence            345789999999999999998865543


No 345
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=82.58  E-value=0.82  Score=47.72  Aligned_cols=20  Identities=20%  Similarity=0.448  Sum_probs=18.6

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +||+++|.+++|||||++++
T Consensus         1 ~KIvivG~~~vGKTSLi~r~   20 (220)
T cd04126           1 LKVVLLGDMNVGKTSLLHRY   20 (220)
T ss_pred             CEEEEECCCCCcHHHHHHHH
Confidence            58999999999999999976


No 346
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=82.57  E-value=0.79  Score=48.03  Aligned_cols=26  Identities=23%  Similarity=0.365  Sum_probs=21.3

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        29 ~Ge~~~i~G~nGsGKSTLl~~laGl~   54 (258)
T PRK14241         29 PRSVTAFIGPSGCGKSTVLRTLNRMH   54 (258)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhccC
Confidence            34568999999999999999886444


No 347
>PRK10908 cell division protein FtsE; Provisional
Probab=82.54  E-value=0.85  Score=46.56  Aligned_cols=27  Identities=30%  Similarity=0.353  Sum_probs=21.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~G~~~   53 (222)
T PRK10908         27 PGEMAFLTGHSGAGKSTLLKLICGIER   53 (222)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            455789999999999999998754443


No 348
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=82.53  E-value=0.88  Score=44.76  Aligned_cols=25  Identities=32%  Similarity=0.345  Sum_probs=20.3

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+==+
T Consensus        25 ~Ge~~~l~G~nGsGKSTLl~~i~G~   49 (163)
T cd03216          25 RGEVHALLGENGAGKSTLMKILSGL   49 (163)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCC
Confidence            3457889999999999999977433


No 349
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.51  E-value=0.85  Score=47.27  Aligned_cols=26  Identities=38%  Similarity=0.480  Sum_probs=21.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~G~~~   52 (242)
T cd03295          27 GEFLVLIGPSGSGKTTTMKMINRLIE   52 (242)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            34588999999999999998864443


No 350
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=82.45  E-value=0.91  Score=47.31  Aligned_cols=22  Identities=23%  Similarity=0.300  Sum_probs=18.4

Q ss_pred             EEEeecCCCCchhHHHHHHHHh
Q 003444          534 LLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy  555 (819)
                      +.+.|+.||||||++|.+.-+.
T Consensus         2 igI~G~sGSGKTTla~~L~~~l   23 (220)
T cd02025           2 IGIAGSVAVGKSTTARVLQALL   23 (220)
T ss_pred             EEeeCCCCCCHHHHHHHHHHHH
Confidence            4578999999999999886554


No 351
>PRK06762 hypothetical protein; Provisional
Probab=82.40  E-value=0.9  Score=44.12  Aligned_cols=24  Identities=38%  Similarity=0.455  Sum_probs=19.7

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      -++|.|..||||||+.+++.-.++
T Consensus         4 li~i~G~~GsGKST~A~~L~~~l~   27 (166)
T PRK06762          4 LIIIRGNSGSGKTTIAKQLQERLG   27 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhC
Confidence            467889999999999999865543


No 352
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=82.37  E-value=0.85  Score=48.10  Aligned_cols=26  Identities=23%  Similarity=0.365  Sum_probs=20.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        26 ~Ge~~~i~G~nGsGKSTLl~~l~Gl~   51 (255)
T PRK11248         26 SGELLVVLGPSGCGKTTLLNLIAGFV   51 (255)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34568999999999999999775443


No 353
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.27  E-value=0.87  Score=47.10  Aligned_cols=26  Identities=31%  Similarity=0.399  Sum_probs=21.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        28 Ge~~~i~G~nGsGKSTLl~~l~Gl~~   53 (239)
T cd03296          28 GELVALLGPSGSGKTTLLRLIAGLER   53 (239)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            34688999999999999998755543


No 354
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=82.25  E-value=0.86  Score=48.38  Aligned_cols=26  Identities=38%  Similarity=0.459  Sum_probs=21.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        33 Ge~~~l~G~nGsGKSTLl~~l~Gl~~   58 (272)
T PRK15056         33 GSIAALVGVNGSGKSTLFKALMGFVR   58 (272)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            45789999999999999998854443


No 355
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=82.22  E-value=0.89  Score=46.63  Aligned_cols=26  Identities=38%  Similarity=0.514  Sum_probs=21.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|+.||||||++|-|-=++
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~Gl~   52 (234)
T cd03251          27 AGETVALVGPSGSGKSTLVNLIPRFY   52 (234)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhccc
Confidence            45578999999999999999875443


No 356
>PRK14527 adenylate kinase; Provisional
Probab=82.15  E-value=0.87  Score=45.66  Aligned_cols=25  Identities=16%  Similarity=0.275  Sum_probs=20.5

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .-++++|+++|||||+.+++---|+
T Consensus         7 ~~i~i~G~pGsGKsT~a~~La~~~~   31 (191)
T PRK14527          7 KVVIFLGPPGAGKGTQAERLAQELG   31 (191)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHHhC
Confidence            4589999999999999998854444


No 357
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=82.13  E-value=0.9  Score=46.13  Aligned_cols=26  Identities=31%  Similarity=0.455  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   52 (207)
T PRK13539         27 AGEALVLTGPNGSGKTTLLRLIAGLL   52 (207)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34578899999999999999875444


No 358
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=82.13  E-value=0.99  Score=45.33  Aligned_cols=21  Identities=33%  Similarity=0.558  Sum_probs=18.5

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +++.|+|.+.+||||+|.++=
T Consensus         1 i~ialvG~PNvGKStLfN~Lt   21 (156)
T PF02421_consen    1 IRIALVGNPNVGKSTLFNALT   21 (156)
T ss_dssp             -EEEEEESTTSSHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHH
Confidence            589999999999999999873


No 359
>PRK14526 adenylate kinase; Provisional
Probab=82.04  E-value=0.9  Score=47.31  Aligned_cols=24  Identities=38%  Similarity=0.448  Sum_probs=19.9

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhc
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      ||+|+|+.||||||+.+.+--.++
T Consensus         2 ~i~l~G~pGsGKsT~a~~La~~~~   25 (211)
T PRK14526          2 KLVFLGPPGSGKGTIAKILSNELN   25 (211)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhC
Confidence            799999999999999988753333


No 360
>PRK04182 cytidylate kinase; Provisional
Probab=82.01  E-value=0.93  Score=43.90  Aligned_cols=20  Identities=25%  Similarity=0.416  Sum_probs=18.5

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      +|+|.|..||||||+.|++-
T Consensus         2 ~I~i~G~~GsGKstia~~la   21 (180)
T PRK04182          2 IITISGPPGSGKTTVARLLA   21 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            68999999999999999984


No 361
>PF07728 AAA_5:  AAA domain (dynein-related subfamily);  InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of this ATPase AAA domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. This ATPase domain includes some proteins not detected by the IPR003959 from INTERPRO model.; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NBX_X 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A.
Probab=82.01  E-value=1  Score=42.43  Aligned_cols=23  Identities=35%  Similarity=0.599  Sum_probs=19.3

Q ss_pred             EEEeecCCCCchhHHHHHHHHhc
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~  556 (819)
                      |||.|+.|+||||+++++--+..
T Consensus         2 vlL~G~~G~GKt~l~~~la~~~~   24 (139)
T PF07728_consen    2 VLLVGPPGTGKTTLARELAALLG   24 (139)
T ss_dssp             EEEEESSSSSHHHHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHHHHhh
Confidence            79999999999999998853333


No 362
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport]
Probab=81.99  E-value=2.4  Score=45.34  Aligned_cols=59  Identities=12%  Similarity=0.213  Sum_probs=44.4

Q ss_pred             cEEEEEecccccccccccccccC---CCCEEEEEEeCCCcccccccCCCCccchHHHHHHHHHHHhccccccC
Q 003444          746 RYQLIRVQARGLGENCKWLEMFE---DIGMVIFCVALSDYDQFSVDGNGSLMNKMMLSRKFFESIVTIQLLIR  815 (819)
Q Consensus       746 ~frLiDVGGQgrsERkKWi~~FE---dVtaVIFvVSLSdYDQ~lED~~G~~~NRM~ESL~LFEsI~nnp~F~~  815 (819)
                      ..+++|+.|. ..-|.|..++|.   .+.+||||||...|+.          |-=.-|.-||+-+.++.--++
T Consensus        83 ~~~LVD~PGH-~rlR~kl~e~~~~~~~akaiVFVVDSa~f~k----------~vrdvaefLydil~~~~~~~~  144 (238)
T KOG0090|consen   83 NVTLVDLPGH-SRLRRKLLEYLKHNYSAKAIVFVVDSATFLK----------NVRDVAEFLYDILLDSRVKKN  144 (238)
T ss_pred             ceEEEeCCCc-HHHHHHHHHHccccccceeEEEEEeccccch----------hhHHHHHHHHHHHHhhccccC
Confidence            4789999998 677888888997   7999999999998764          333356667776666654333


No 363
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=81.95  E-value=2.8  Score=40.27  Aligned_cols=36  Identities=8%  Similarity=0.229  Sum_probs=30.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+..|..++.+++++++|.++++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~~d~~i~v~~~~~   84 (175)
T cd01870          49 VELALWDTAGQ-EDYDRLRPLSYPDTDVILMCFSIDS   84 (175)
T ss_pred             EEEEEEeCCCc-hhhhhccccccCCCCEEEEEEECCC
Confidence            67899999998 5566778778899999999999875


No 364
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=81.95  E-value=0.64  Score=41.16  Aligned_cols=16  Identities=31%  Similarity=0.667  Sum_probs=0.0

Q ss_pred             EeecCCCCchhHHHHH
Q 003444          536 LVGCSGSGTSTIFKQA  551 (819)
Q Consensus       536 LLGaGESGKSTIlKQM  551 (819)
                      ++|..+|||||+++.+
T Consensus         1 iiG~~~~GKStl~~~l   16 (157)
T cd00882           1 VVGDSGVGKTSLLNRL   16 (157)
T ss_pred             CCCcCCCcHHHHHHHH


No 365
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]
Probab=81.94  E-value=0.84  Score=51.44  Aligned_cols=23  Identities=26%  Similarity=0.450  Sum_probs=18.0

Q ss_pred             EEEeecCCCCchhHHHHHHHHhc
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +-|||++||||||+|+-+==+..
T Consensus        34 ~~lLGPSGcGKTTlLR~IAGfe~   56 (352)
T COG3842          34 VTLLGPSGCGKTTLLRMIAGFEQ   56 (352)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCC
Confidence            45999999999999987643333


No 366
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=81.94  E-value=0.91  Score=46.95  Aligned_cols=26  Identities=31%  Similarity=0.545  Sum_probs=21.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        27 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   52 (242)
T PRK11124         27 QGETLVLLGPSGAGKSSLLRVLNLLE   52 (242)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34568999999999999999876444


No 367
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=81.91  E-value=1.3  Score=47.96  Aligned_cols=26  Identities=27%  Similarity=0.489  Sum_probs=21.5

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      --+.++|.+||||||+||-+--+..+
T Consensus        31 E~VaiIG~SGaGKSTLLR~lngl~d~   56 (258)
T COG3638          31 EMVAIIGPSGAGKSTLLRSLNGLVDP   56 (258)
T ss_pred             cEEEEECCCCCcHHHHHHHHhcccCC
Confidence            35789999999999999988765543


No 368
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=81.90  E-value=0.92  Score=42.55  Aligned_cols=37  Identities=14%  Similarity=0.163  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      ..+++||++|+ ...+..|.++|.+++++|||+|+++-
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~~d~~ilv~D~~~~   85 (168)
T cd04119          49 VRVNFFDLSGH-PEYLEVRNEFYKDTQGVLLVYDVTDR   85 (168)
T ss_pred             EEEEEEECCcc-HHHHHHHHHHhccCCEEEEEEECCCH
Confidence            68999999998 45667788899999999999999863


No 369
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=81.86  E-value=0.89  Score=46.22  Aligned_cols=26  Identities=23%  Similarity=0.317  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=+.
T Consensus        23 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   48 (213)
T TIGR01277        23 DGEIVAIMGPSGAGKSTLLNLIAGFI   48 (213)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhcCC
Confidence            35578999999999999999875444


No 370
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=81.86  E-value=0.91  Score=48.10  Aligned_cols=25  Identities=36%  Similarity=0.418  Sum_probs=20.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=+.
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~Gl~   51 (271)
T PRK13638         27 SPVTGLVGANGCGKSTLFMNLSGLL   51 (271)
T ss_pred             CCEEEEECCCCCCHHHHHHHHcCCC
Confidence            4568999999999999999775433


No 371
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=81.77  E-value=0.93  Score=46.75  Aligned_cols=26  Identities=19%  Similarity=0.258  Sum_probs=21.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        31 Ge~~~i~G~nGsGKSTLl~~l~G~~~   56 (237)
T PRK11614         31 GEIVTLIGANGAGKTTLLGTLCGDPR   56 (237)
T ss_pred             CcEEEEECCCCCCHHHHHHHHcCCCC
Confidence            44688999999999999998854443


No 372
>PRK14738 gmk guanylate kinase; Provisional
Probab=81.77  E-value=0.97  Score=46.35  Aligned_cols=23  Identities=17%  Similarity=0.390  Sum_probs=19.5

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +..-++|.|++||||||+++++.
T Consensus        12 ~~~~ivi~GpsG~GK~tl~~~L~   34 (206)
T PRK14738         12 KPLLVVISGPSGVGKDAVLARMR   34 (206)
T ss_pred             CCeEEEEECcCCCCHHHHHHHHH
Confidence            44567789999999999999985


No 373
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=81.75  E-value=0.91  Score=45.81  Aligned_cols=24  Identities=25%  Similarity=0.228  Sum_probs=20.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        26 G~~~~i~G~nGsGKSTLl~~l~Gl   49 (208)
T cd03268          26 GEIYGFLGPNGAGKTTTMKIILGL   49 (208)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            456889999999999999987533


No 374
>PRK14528 adenylate kinase; Provisional
Probab=81.74  E-value=1.2  Score=45.09  Aligned_cols=25  Identities=20%  Similarity=0.282  Sum_probs=20.7

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .+++++|+.||||||+.+++.--|+
T Consensus         2 ~~i~i~G~pGsGKtt~a~~la~~~~   26 (186)
T PRK14528          2 KNIIFMGPPGAGKGTQAKILCERLS   26 (186)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHHhC
Confidence            3689999999999999999854443


No 375
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=81.65  E-value=0.93  Score=44.75  Aligned_cols=26  Identities=35%  Similarity=0.423  Sum_probs=21.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|+.||||||++|-+-=++.
T Consensus        28 Ge~~~i~G~nGsGKStLl~~l~G~~~   53 (173)
T cd03246          28 GESLAIIGPSGSGKSTLARLILGLLR   53 (173)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhccC
Confidence            44688999999999999998865543


No 376
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=81.55  E-value=0.97  Score=45.69  Aligned_cols=26  Identities=31%  Similarity=0.290  Sum_probs=21.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        24 Ge~~~l~G~nGsGKSTLl~~l~gl~~   49 (211)
T cd03298          24 GEITAIVGPSGSGKSTLLNLIAGFET   49 (211)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            45689999999999999998754443


No 377
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=81.54  E-value=0.95  Score=48.07  Aligned_cols=25  Identities=36%  Similarity=0.356  Sum_probs=20.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        38 Ge~~~I~G~NGsGKSTLlk~l~Gl~   62 (257)
T PRK11247         38 GQFVAVVGRSGCGKSTLLRLLAGLE   62 (257)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCC
Confidence            4468999999999999999775333


No 378
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=81.53  E-value=0.96  Score=47.10  Aligned_cols=26  Identities=35%  Similarity=0.264  Sum_probs=21.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        28 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   53 (253)
T TIGR02323        28 PGEVLGIVGESGSGKSTLLGCLAGRL   53 (253)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCC
Confidence            35578999999999999999765444


No 379
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=81.52  E-value=1  Score=43.54  Aligned_cols=26  Identities=38%  Similarity=0.470  Sum_probs=21.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.++|+|..||||||++|.+--++.
T Consensus        25 g~~~~i~G~nGsGKStll~~l~g~~~   50 (157)
T cd00267          25 GEIVALVGPNGSGKSTLLRAIAGLLK   50 (157)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            35788999999999999998865543


No 380
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=81.49  E-value=1  Score=46.00  Aligned_cols=20  Identities=35%  Similarity=0.647  Sum_probs=18.5

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      +|||+|..+|||||++.++.
T Consensus         2 ~vll~G~~~sGKTsL~~~l~   21 (203)
T cd04105           2 TVLLLGPSDSGKTALFTKLT   21 (203)
T ss_pred             eEEEEcCCCCCHHHHHHHHh
Confidence            58999999999999999885


No 381
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=81.47  E-value=0.96  Score=47.75  Aligned_cols=27  Identities=33%  Similarity=0.292  Sum_probs=21.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        36 ~Ge~~~i~G~nGsGKSTLl~~l~Gl~~   62 (265)
T TIGR02769        36 EGETVGLLGRSGCGKSTLARLLLGLEK   62 (265)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            355788999999999999997765543


No 382
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=81.44  E-value=1.4  Score=41.90  Aligned_cols=36  Identities=3%  Similarity=0.014  Sum_probs=30.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ..-+..|..++++++++|||+|+++
T Consensus        52 ~~~~l~D~~g~-~~~~~~~~~~~~~~~~~i~v~d~~~   87 (165)
T cd01868          52 IKAQIWDTAGQ-ERYRAITSAYYRGAVGALLVYDITK   87 (165)
T ss_pred             EEEEEEeCCCh-HHHHHHHHHHHCCCCEEEEEEECcC
Confidence            67999999998 4455667888999999999999984


No 383
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=81.41  E-value=0.92  Score=49.04  Aligned_cols=21  Identities=33%  Similarity=0.518  Sum_probs=18.0

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --+.|+|+.||||||++|-+=
T Consensus        31 ~~~~iiGPNGaGKSTLlK~iL   51 (254)
T COG1121          31 EITALIGPNGAGKSTLLKAIL   51 (254)
T ss_pred             cEEEEECCCCCCHHHHHHHHh
Confidence            356799999999999999764


No 384
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=81.41  E-value=0.7  Score=41.73  Aligned_cols=16  Identities=25%  Similarity=0.544  Sum_probs=14.4

Q ss_pred             EeecCCCCchhHHHHH
Q 003444          536 LVGCSGSGTSTIFKQA  551 (819)
Q Consensus       536 LLGaGESGKSTIlKQM  551 (819)
                      |+|..+|||||+++++
T Consensus         1 i~G~~gsGKstl~~~l   16 (163)
T cd00880           1 LFGRTNAGKSSLLNAL   16 (163)
T ss_pred             CcCCCCCCHHHHHHHH
Confidence            5899999999999975


No 385
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=81.41  E-value=0.97  Score=47.12  Aligned_cols=27  Identities=41%  Similarity=0.482  Sum_probs=21.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~l~G~~~   51 (252)
T TIGR03005        25 AGEKVALIGPSGSGKSTILRILMTLEP   51 (252)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            345689999999999999998865544


No 386
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=81.39  E-value=0.97  Score=47.05  Aligned_cols=26  Identities=27%  Similarity=0.516  Sum_probs=20.8

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        30 ~Ge~~~l~G~nGsGKSTLl~~l~Gl~   55 (255)
T PRK11300         30 EQEIVSLIGPNGAGKTTVFNCLTGFY   55 (255)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHhCCc
Confidence            34578999999999999999765443


No 387
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=81.39  E-value=0.97  Score=47.70  Aligned_cols=25  Identities=20%  Similarity=0.278  Sum_probs=20.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=+.
T Consensus        25 Ge~~~i~G~NGsGKSTLlk~L~G~~   49 (246)
T cd03237          25 SEVIGILGPNGIGKTTFIKMLAGVL   49 (246)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCC
Confidence            3467899999999999999875443


No 388
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=81.35  E-value=1  Score=45.81  Aligned_cols=26  Identities=38%  Similarity=0.556  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        29 ~G~~~~i~G~nGsGKSTLl~~i~G~~   54 (220)
T cd03245          29 AGEKVAIIGRVGSGKSTLLKLLAGLY   54 (220)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCc
Confidence            34568899999999999999876444


No 389
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=81.28  E-value=1  Score=46.60  Aligned_cols=26  Identities=31%  Similarity=0.469  Sum_probs=21.3

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        27 Ge~~~l~G~nGsGKSTLl~~l~G~~~   52 (240)
T PRK09493         27 GEVVVIIGPSGSGKSTLLRCINKLEE   52 (240)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCCC
Confidence            44688999999999999998765544


No 390
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=81.28  E-value=0.97  Score=45.00  Aligned_cols=20  Identities=35%  Similarity=0.700  Sum_probs=17.8

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      |++|+|..+|||||++..+.
T Consensus         3 rimliG~~g~GKTTL~q~L~   22 (143)
T PF10662_consen    3 RIMLIGPSGSGKTTLAQALN   22 (143)
T ss_pred             eEEEECCCCCCHHHHHHHHc
Confidence            89999999999999987654


No 391
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.22  E-value=1  Score=46.87  Aligned_cols=24  Identities=38%  Similarity=0.418  Sum_probs=19.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~l~Gl   52 (241)
T PRK14250         29 GAIYTIVGPSGAGKSTLIKLINRL   52 (241)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            346899999999999999977533


No 392
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=81.20  E-value=0.93  Score=48.51  Aligned_cols=42  Identities=21%  Similarity=0.376  Sum_probs=27.3

Q ss_pred             EEEeecCCCCchhHHHHHH--HHhcC----------CCCCHHHhhhhHHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAK--ILYKA----------VPFSDDEHENIKLKIQSN  575 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMK--ILy~p----------~GFS~eEr~~~K~iIqsN  575 (819)
                      +-+||+.|+||||++|++-  +....          ..+...|+...|.+...|
T Consensus        30 ~ailGPNGAGKSTlLk~LsGel~p~~G~v~~~g~~l~~~~~~~lA~~raVlpQ~   83 (259)
T COG4559          30 LAILGPNGAGKSTLLKALSGELSPDSGEVTLNGVPLNSWPPEELARHRAVLPQN   83 (259)
T ss_pred             EEEECCCCccHHHHHHHhhCccCCCCCeEeeCCcChhhCCHHHHHHHhhhcccC
Confidence            5689999999999999974  11110          224556666666555544


No 393
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=81.10  E-value=1  Score=46.56  Aligned_cols=24  Identities=33%  Similarity=0.421  Sum_probs=19.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        11 Ge~~~i~G~nGsGKSTLl~~l~Gl   34 (230)
T TIGR01184        11 GEFISLIGHSGCGKSTLLNLISGL   34 (230)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCC
Confidence            346889999999999999977533


No 394
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=81.09  E-value=0.96  Score=47.09  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=19.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --.+.|+|..||||||++|-+-
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14245         29 KSVVAFIGPSGCGKSTFLRLFN   50 (250)
T ss_pred             CCEEEEECCCCCCHHHHHHHHh
Confidence            3458899999999999999884


No 395
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=81.09  E-value=1  Score=46.53  Aligned_cols=26  Identities=15%  Similarity=0.226  Sum_probs=20.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        27 ~Ge~~~l~G~nGsGKSTLl~~l~G~~   52 (242)
T TIGR03411        27 PGELRVIIGPNGAGKTTMMDVITGKT   52 (242)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCC
Confidence            34568999999999999998775443


No 396
>PRK00625 shikimate kinase; Provisional
Probab=81.05  E-value=1  Score=45.46  Aligned_cols=21  Identities=19%  Similarity=0.295  Sum_probs=18.8

Q ss_pred             eEEEeecCCCCchhHHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAKI  553 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKI  553 (819)
                      .|+|+|..||||||+.|++.-
T Consensus         2 ~I~LiG~pGsGKTT~~k~La~   22 (173)
T PRK00625          2 QIFLCGLPTVGKTSFGKALAK   22 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            589999999999999999843


No 397
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]
Probab=81.04  E-value=0.95  Score=50.77  Aligned_cols=24  Identities=33%  Similarity=0.512  Sum_probs=20.9

Q ss_pred             EEEeecCCCCchhHHHHHHHHhcC
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +.|||++||||||+|+-+-=|..|
T Consensus        32 ~vllGPSGcGKSTlLr~IAGLe~~   55 (338)
T COG3839          32 VVLLGPSGCGKSTLLRMIAGLEEP   55 (338)
T ss_pred             EEEECCCCCCHHHHHHHHhCCCCC
Confidence            689999999999999988766665


No 398
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=81.03  E-value=1  Score=48.75  Aligned_cols=26  Identities=27%  Similarity=0.244  Sum_probs=21.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|+.||||||++|-+-=+.
T Consensus        29 ~Ge~~~l~G~NGaGKSTLl~~l~Gl~   54 (303)
T TIGR01288        29 RGECFGLLGPNGAGKSTIARMLLGMI   54 (303)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCC
Confidence            34578999999999999999885443


No 399
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type. E. coli NadR has also been found to regulate the import of its substrate, nicotinamide ribonucleotide, but it is not known if the other members of this model share that activity.
Probab=81.02  E-value=1.1  Score=49.48  Aligned_cols=29  Identities=14%  Similarity=0.398  Sum_probs=24.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhcCCCC
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYKAVPF  560 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~p~GF  560 (819)
                      ..+++|+|++++||||+++++--+++ ..+
T Consensus       162 ~~~~~~~G~~~~gkstl~~~l~~~~~-~~~  190 (325)
T TIGR01526       162 VKTVAILGGESTGKSTLVNKLAAVFN-TTS  190 (325)
T ss_pred             CcEEEEECCCCCCHHHHHHHHHHhhC-CCE
Confidence            44899999999999999999988877 444


No 400
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=81.01  E-value=1  Score=47.11  Aligned_cols=20  Identities=35%  Similarity=0.526  Sum_probs=17.8

Q ss_pred             EEEeecCCCCchhHHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAKI  553 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKI  553 (819)
                      |+|.|.++|||||+.+++.-
T Consensus         2 Ivl~G~pGSGKST~a~~La~   21 (249)
T TIGR03574         2 IILTGLPGVGKSTFSKELAK   21 (249)
T ss_pred             EEEEcCCCCCHHHHHHHHHH
Confidence            68899999999999999853


No 401
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=81.01  E-value=1.1  Score=44.49  Aligned_cols=37  Identities=5%  Similarity=0.097  Sum_probs=31.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+ ...+..|..+|.+++++|||+|+++-
T Consensus        50 ~~~~i~Dt~G~-~~~~~~~~~~~~~ad~~i~v~D~~~~   86 (191)
T cd04112          50 VKLQIWDTAGQ-ERFRSVTHAYYRDAHALLLLYDITNK   86 (191)
T ss_pred             EEEEEEeCCCc-HHHHHhhHHHccCCCEEEEEEECCCH
Confidence            68999999998 55666688899999999999999863


No 402
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=80.98  E-value=1  Score=44.39  Aligned_cols=27  Identities=44%  Similarity=0.572  Sum_probs=21.4

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        27 ~G~~~~l~G~nGsGKstLl~~i~G~~~   53 (171)
T cd03228          27 PGEKVAIVGPSGSGKSTLLKLLLRLYD   53 (171)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHcCCC
Confidence            345689999999999999998754443


No 403
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=80.94  E-value=1  Score=47.73  Aligned_cols=25  Identities=20%  Similarity=0.206  Sum_probs=20.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        33 Ge~~~i~G~nGsGKSTLl~~l~Gl~   57 (269)
T PRK11831         33 GKITAIMGPSGIGKTTLLRLIGGQI   57 (269)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCC
Confidence            4468999999999999999775444


No 404
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=80.91  E-value=1.1  Score=45.11  Aligned_cols=26  Identities=15%  Similarity=0.327  Sum_probs=20.9

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        26 Ge~~~l~G~nGsGKSTLl~~l~G~~~   51 (195)
T PRK13541         26 SAITYIKGANGCGKSSLLRMIAGIMQ   51 (195)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhcCCC
Confidence            34789999999999999988754443


No 405
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=80.90  E-value=0.95  Score=43.59  Aligned_cols=37  Identities=8%  Similarity=0.012  Sum_probs=32.4

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      ..+++||+.|+ ...+..|..+|.+++++|||+|.++.
T Consensus        67 ~~~~l~Dt~G~-~~~~~~~~~~~~~ad~~i~v~D~~~~  103 (179)
T cd01890          67 YLLNLIDTPGH-VDFSYEVSRSLAACEGALLLVDATQG  103 (179)
T ss_pred             EEEEEEECCCC-hhhHHHHHHHHHhcCeEEEEEECCCC
Confidence            67889999998 56778888899999999999999864


No 406
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter. This model describes ABC-type bacteriocin transporter. The amino terminal domain (pfam03412) processes the N-terminal leader peptide from the bacteriocin while C-terminal domains resemble ABC transporter membrane protein and ATP-binding cassette domain. In general, bacteriocins are agents which are responsible for killing or inhibiting the closely related species or even different strains of the same species. Bacteriocins are usually encoded by bacterial plasmids. Bacteriocins are named after the species and hence in literature one encounters various names e.g., leucocin from Leuconostic geldium; pedicocin from Pedicoccus acidilactici; sakacin from Lactobacillus sake etc.
Probab=80.88  E-value=1.4  Score=52.84  Aligned_cols=30  Identities=37%  Similarity=0.418  Sum_probs=25.1

Q ss_pred             hcceeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          528 RRTLQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       528 ~k~~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      -+.--++.++|..||||||++|-+-=+|.|
T Consensus       497 i~~G~~vaIvG~SGsGKSTLlklL~gl~~p  526 (708)
T TIGR01193       497 IKMNSKTTIVGMSGSGKSTLAKLLVGFFQA  526 (708)
T ss_pred             ECCCCEEEEECCCCCCHHHHHHHHhccCCC
Confidence            344678999999999999999999767765


No 407
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=80.84  E-value=1.1  Score=43.99  Aligned_cols=36  Identities=6%  Similarity=0.056  Sum_probs=31.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+..|..+|.+++++|||+|+++
T Consensus        49 ~~~~i~Dt~g~-~~~~~~~~~~~~~~d~iilv~d~~~   84 (188)
T cd04125          49 IKLQIWDTNGQ-ERFRSLNNSYYRGAHGYLLVYDVTD   84 (188)
T ss_pred             EEEEEEECCCc-HHHHhhHHHHccCCCEEEEEEECcC
Confidence            68899999998 5566689999999999999999875


No 408
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional
Probab=80.83  E-value=1.4  Score=51.63  Aligned_cols=32  Identities=28%  Similarity=0.293  Sum_probs=26.6

Q ss_pred             HHhcceeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          526 IERRTLQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       526 ~~~k~~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      .+-+.-.|++++|..||||||++|-+-=+|.|
T Consensus       362 l~i~~Ge~iaIvG~SGsGKSTLl~lL~gl~~p  393 (592)
T PRK10790        362 LSVPSRGFVALVGHTGSGKSTLASLLMGYYPL  393 (592)
T ss_pred             EEEcCCCEEEEECCCCCCHHHHHHHHhcccCC
Confidence            34455789999999999999999999767765


No 409
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=80.79  E-value=1  Score=46.87  Aligned_cols=25  Identities=32%  Similarity=0.437  Sum_probs=20.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        27 Ge~~~i~G~nGsGKSTLl~~l~G~~   51 (247)
T TIGR00972        27 NQVTALIGPSGCGKSTLLRSLNRMN   51 (247)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhccC
Confidence            4468899999999999999885444


No 410
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.79  E-value=1.1  Score=46.91  Aligned_cols=27  Identities=26%  Similarity=0.352  Sum_probs=21.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        32 ~Ge~~~i~G~nGsGKSTLl~~l~Gl~~   58 (254)
T PRK14273         32 KNSITALIGPSGCGKSTFLRTLNRMND   58 (254)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcccc
Confidence            345788999999999999998854443


No 411
>PLN00023 GTP-binding protein; Provisional
Probab=80.78  E-value=1.1  Score=50.21  Aligned_cols=24  Identities=29%  Similarity=0.394  Sum_probs=21.2

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ...+||+|||.+++|||||++++.
T Consensus        19 ~~~iKIVLLGdsGVGKTSLI~rf~   42 (334)
T PLN00023         19 CGQVRVLVVGDSGVGKSSLVHLIV   42 (334)
T ss_pred             ccceEEEEECCCCCcHHHHHHHHh
Confidence            456899999999999999998874


No 412
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.76  E-value=1  Score=46.97  Aligned_cols=26  Identities=31%  Similarity=0.413  Sum_probs=20.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        29 ~Ge~~~l~G~nGsGKSTLl~~l~G~~   54 (253)
T PRK14267         29 QNGVFALMGPSGCGKSTLLRTFNRLL   54 (253)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhccC
Confidence            34467899999999999999875444


No 413
>PRK14737 gmk guanylate kinase; Provisional
Probab=80.74  E-value=1  Score=45.82  Aligned_cols=19  Identities=26%  Similarity=0.518  Sum_probs=17.3

Q ss_pred             EEEeecCCCCchhHHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMK  552 (819)
                      ++|.|++|||||||.|++.
T Consensus         7 ivl~GpsG~GK~tl~~~l~   25 (186)
T PRK14737          7 FIISSVAGGGKSTIIQALL   25 (186)
T ss_pred             EEEECCCCCCHHHHHHHHH
Confidence            6789999999999999984


No 414
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=80.74  E-value=1.1  Score=46.17  Aligned_cols=25  Identities=36%  Similarity=0.416  Sum_probs=20.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|+.||||||++|-+-=+
T Consensus        32 ~Ge~~~i~G~nGsGKSTLl~~l~G~   56 (225)
T PRK10247         32 AGEFKLITGPSGCGKSTLLKIVASL   56 (225)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcc
Confidence            3456899999999999999976433


No 415
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=80.71  E-value=1.1  Score=47.80  Aligned_cols=27  Identities=41%  Similarity=0.273  Sum_probs=22.3

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      --.+.|+|+.||||||++|-+-=++.|
T Consensus        26 Ge~~~IvG~nGsGKSTLlk~l~Gl~~p   52 (255)
T cd03236          26 GQVLGLVGPNGIGKSTALKILAGKLKP   52 (255)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCcCC
Confidence            457899999999999999988655553


No 416
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=80.70  E-value=1  Score=45.94  Aligned_cols=27  Identities=33%  Similarity=0.375  Sum_probs=21.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        33 ~Ge~~~l~G~nGsGKSTLl~~i~G~~~   59 (224)
T TIGR02324        33 AGECVALSGPSGAGKSTLLKSLYANYL   59 (224)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            345789999999999999997754443


No 417
>PF04670 Gtr1_RagA:  Gtr1/RagA G protein conserved region;  InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1. RCC1 catalyzes guanine nucleotide exchange on Ran, a well characterised nuclear Ras-like small G protein that plays an essential role in the import and export of proteins and RNAs across the nuclear membrane through the nuclear pore complex. RCC1 is located inside the nucleus, bound to chromatin. The concentration of GTP within the cell is ~30 times higher than the concentration of GDP, thus resulting in the preferential production of the GTP form of Ran by RCC1 within the nucleus. Gtr1p is located within both the cytoplasm and the nucleus and has been reported to play a role in cell growth. Biochemical analysis revealed that Gtr1 is in fact a G protein of the Ras family. The RagA/B proteins are the human homologues of Gtr1 and Rag A and Gtr1p belong to the sixth subfamily of the Ras-like small GTPase superfamily []. ; GO: 0005525 GTP binding, 0005634 nucleus, 0005737 cytoplasm; PDB: 3R7W_B 2Q3F_B 3LLU_A.
Probab=80.67  E-value=1.1  Score=47.53  Aligned_cols=35  Identities=26%  Similarity=0.512  Sum_probs=22.0

Q ss_pred             eEEEeecCCCCchhHHHHHHHHhcCCCCCHHHhhhhHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILYKAVPFSDDEHENIKLKI  572 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy~p~GFS~eEr~~~K~iI  572 (819)
                      ||||+|..+||||++.+   ++++  .+.+.|-..+-..+
T Consensus         1 KiLLmG~~~SGKTSi~~---vIF~--~~~p~dT~~L~~T~   35 (232)
T PF04670_consen    1 KILLMGPRRSGKTSIRS---VIFH--KYSPRDTLRLEPTI   35 (232)
T ss_dssp             EEEEEESTTSSHHHHHH---HHHS-----GGGGGG-----
T ss_pred             CEEEEcCCCCChhhHHH---HHHc--CCCchhccccCCcC
Confidence            89999999999999875   4554  26666766554443


No 418
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=80.64  E-value=1.2  Score=48.32  Aligned_cols=21  Identities=29%  Similarity=0.455  Sum_probs=19.4

Q ss_pred             eeeEEEeecCCCCchhHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..+||++|..|+|||||++-+
T Consensus         4 ~fnImVvG~sG~GKTTFIntL   24 (281)
T PF00735_consen    4 NFNIMVVGESGLGKTTFINTL   24 (281)
T ss_dssp             EEEEEEEECTTSSHHHHHHHH
T ss_pred             eEEEEEECCCCCCHHHHHHHH
Confidence            578999999999999999976


No 419
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=80.57  E-value=1.1  Score=45.31  Aligned_cols=24  Identities=17%  Similarity=0.301  Sum_probs=19.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        27 Ge~~~l~G~nGsGKSTLl~~l~G~   50 (204)
T PRK13538         27 GELVQIEGPNGAGKTSLLRILAGL   50 (204)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCC
Confidence            347889999999999999876433


No 420
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=80.57  E-value=1.1  Score=46.17  Aligned_cols=25  Identities=28%  Similarity=0.406  Sum_probs=20.7

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      -.+.|+|..||||||++|-+-=++.
T Consensus         7 e~~~l~G~nGsGKSTLl~~l~G~~~   31 (223)
T TIGR03771         7 ELLGLLGPNGAGKTTLLRAILGLIP   31 (223)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCCC
Confidence            4688999999999999998764443


No 421
>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport.  These families are characterised by the fact that the ABC subunit is made up of duplicated, fused ABC modules (ABC2).  No known transmembrane proteins or domains are associated with these proteins.
Probab=80.52  E-value=1.3  Score=43.57  Aligned_cols=25  Identities=28%  Similarity=0.426  Sum_probs=21.5

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      -.+++.|+.+|||||++|++.++..
T Consensus        22 ~~~~i~G~NgsGKS~~l~~i~~~~~   46 (162)
T cd03227          22 SLTIITGPNGSGKSTILDAIGLALG   46 (162)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHH
Confidence            4678999999999999999876655


No 422
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=80.50  E-value=1.5  Score=47.60  Aligned_cols=24  Identities=38%  Similarity=0.555  Sum_probs=20.0

Q ss_pred             EEEeecCCCCchhHHHHHHHHhcC
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +-++|.+||||||++|++--+-.|
T Consensus        37 ~~iiGgSGsGKStlLr~I~Gll~P   60 (263)
T COG1127          37 LAILGGSGSGKSTLLRLILGLLRP   60 (263)
T ss_pred             EEEECCCCcCHHHHHHHHhccCCC
Confidence            457899999999999998765554


No 423
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=80.50  E-value=1.1  Score=46.26  Aligned_cols=27  Identities=33%  Similarity=0.481  Sum_probs=21.4

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        26 ~Ge~~~i~G~nGsGKSTLl~~l~G~~~   52 (236)
T TIGR03864        26 PGEFVALLGPNGAGKSTLFSLLTRLYV   52 (236)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCcC
Confidence            345788999999999999998754443


No 424
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=80.48  E-value=1.1  Score=46.98  Aligned_cols=26  Identities=38%  Similarity=0.325  Sum_probs=21.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        28 ~Ge~~~l~G~nGsGKSTLl~~l~Gl~   53 (254)
T PRK10418         28 RGRVLALVGGSGSGKSLTCAAALGIL   53 (254)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34578999999999999998875444


No 425
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=80.48  E-value=1.2  Score=44.54  Aligned_cols=26  Identities=19%  Similarity=0.198  Sum_probs=21.7

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhcCCCCC
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYKAVPFS  561 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~p~GFS  561 (819)
                      +|+++||.+++|||+|++++.  +  +.|.
T Consensus         2 ~kivv~G~~~vGKTsli~~~~--~--~~f~   27 (176)
T cd04133           2 IKCVTVGDGAVGKTCMLICYT--S--NKFP   27 (176)
T ss_pred             eEEEEECCCCCcHHHHHHHHh--c--CCCC
Confidence            699999999999999998864  3  3574


No 426
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=80.45  E-value=1.2  Score=42.69  Aligned_cols=36  Identities=8%  Similarity=0.117  Sum_probs=31.6

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ...+..|..+|.+++++|||.++++
T Consensus        54 ~~l~i~D~~G~-~~~~~~~~~~~~~~d~~i~v~d~~~   89 (170)
T cd04116          54 VTLQIWDTAGQ-ERFRSLRTPFYRGSDCCLLTFAVDD   89 (170)
T ss_pred             EEEEEEeCCCh-HHHHHhHHHHhcCCCEEEEEEECCC
Confidence            68999999998 5667788899999999999999875


No 427
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.44  E-value=1.1  Score=46.59  Aligned_cols=26  Identities=35%  Similarity=0.377  Sum_probs=21.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        28 ~Ge~~~i~G~nGsGKSTLl~~i~G~~   53 (250)
T PRK14247         28 DNTITALMGPSGSGKSTLLRVFNRLI   53 (250)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhccC
Confidence            34568999999999999999875443


No 428
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=80.43  E-value=1.1  Score=46.73  Aligned_cols=22  Identities=36%  Similarity=0.481  Sum_probs=19.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --.+.|+|..||||||++|-+-
T Consensus        29 Ge~~~i~G~nGsGKSTLl~~i~   50 (250)
T PRK14240         29 NQVTALIGPSGCGKSTFLRTLN   50 (250)
T ss_pred             CCEEEEECCCCCCHHHHHHHHh
Confidence            4458999999999999999875


No 429
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=80.41  E-value=1.1  Score=45.14  Aligned_cols=26  Identities=23%  Similarity=0.223  Sum_probs=21.3

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        34 ~Ge~~~l~G~nGsGKStLl~~i~Gl~   59 (194)
T cd03213          34 PGELTAIMGPSGAGKSTLLNALAGRR   59 (194)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCC
Confidence            34578999999999999999875444


No 430
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=80.37  E-value=1.1  Score=45.42  Aligned_cols=25  Identities=32%  Similarity=0.240  Sum_probs=20.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        25 ~Ge~~~i~G~nGsGKStLl~~l~G~   49 (200)
T cd03217          25 KGEVHALMGPNGSGKSTLAKTIMGH   49 (200)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCC
Confidence            4557899999999999999977443


No 431
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.36  E-value=1.1  Score=47.46  Aligned_cols=22  Identities=32%  Similarity=0.463  Sum_probs=19.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --.+.|+|..||||||++|-+-
T Consensus        47 Ge~~~i~G~nGsGKSTLl~~l~   68 (268)
T PRK14248         47 HAVTALIGPSGCGKSTFLRSIN   68 (268)
T ss_pred             CCEEEEECCCCCCHHHHHHHHH
Confidence            4468999999999999999874


No 432
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=80.35  E-value=1.1  Score=45.73  Aligned_cols=18  Identities=39%  Similarity=0.610  Sum_probs=16.1

Q ss_pred             EEEeecCCCCchhHHHHH
Q 003444          534 LLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQM  551 (819)
                      +|+.|+.||||||+++.+
T Consensus         4 ilI~GptGSGKTTll~~l   21 (198)
T cd01131           4 VLVTGPTGSGKSTTLAAM   21 (198)
T ss_pred             EEEECCCCCCHHHHHHHH
Confidence            688999999999999863


No 433
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.35  E-value=1.1  Score=46.56  Aligned_cols=24  Identities=29%  Similarity=0.407  Sum_probs=20.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        30 Ge~~~i~G~nGsGKSTLl~~l~Gl   53 (251)
T PRK14251         30 KELTALIGPSGCGKSTFLRCLNRM   53 (251)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhhc
Confidence            346899999999999999987534


No 434
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=80.32  E-value=1  Score=47.26  Aligned_cols=27  Identities=30%  Similarity=0.471  Sum_probs=21.6

Q ss_pred             cceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      +.--.+.|+|..||||||++|-+-=++
T Consensus        37 ~~Ge~~~i~G~nGsGKSTLl~~l~Gl~   63 (260)
T PRK10744         37 AKNQVTAFIGPSGCGKSTLLRTFNRMY   63 (260)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHhccc
Confidence            345578999999999999999885443


No 435
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=80.30  E-value=1.1  Score=48.93  Aligned_cols=27  Identities=22%  Similarity=0.394  Sum_probs=21.9

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      +--.+.|+|+.||||||++|-+-=++.
T Consensus        32 ~Ge~v~iiG~nGsGKSTLl~~L~Gl~~   58 (305)
T PRK13651         32 QGEFIAIIGQTGSGKTTFIEHLNALLL   58 (305)
T ss_pred             CCCEEEEECCCCCcHHHHHHHHhCCCC
Confidence            345789999999999999998864443


No 436
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains.  The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence.  This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=80.28  E-value=1.3  Score=45.52  Aligned_cols=22  Identities=36%  Similarity=0.552  Sum_probs=19.4

Q ss_pred             eEEEeecCCCCchhHHHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKIL  554 (819)
                      -++++|+.||||||+++.+...
T Consensus        24 ~~~i~G~NGsGKTTLl~ai~~~   45 (204)
T cd03240          24 LTLIVGQNGAGKTTIIEALKYA   45 (204)
T ss_pred             eEEEECCCCCCHHHHHHHHHHH
Confidence            6789999999999999998644


No 437
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=80.26  E-value=1.4  Score=44.34  Aligned_cols=23  Identities=26%  Similarity=0.537  Sum_probs=19.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ..-.+++.|..||||||+++.+-
T Consensus        24 ~g~~i~I~G~tGSGKTTll~aL~   46 (186)
T cd01130          24 ARKNILISGGTGSGKTTLLNALL   46 (186)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHH
Confidence            34568999999999999998753


No 438
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=80.25  E-value=1.1  Score=46.48  Aligned_cols=22  Identities=36%  Similarity=0.528  Sum_probs=19.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --.+.|+|..||||||++|-+-
T Consensus        31 Ge~~~i~G~nGsGKSTLl~~l~   52 (252)
T PRK14239         31 NEITALIGPSGSGKSTLLRSIN   52 (252)
T ss_pred             CcEEEEECCCCCCHHHHHHHHh
Confidence            3458999999999999999884


No 439
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]
Probab=80.22  E-value=1  Score=54.93  Aligned_cols=31  Identities=45%  Similarity=0.521  Sum_probs=27.0

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +-+.--++.++|.+||||||++|-|.=+|.|
T Consensus       495 ~I~~Ge~vaIvG~SGsGKSTL~KLL~gly~p  525 (709)
T COG2274         495 EIPPGEKVAIVGRSGSGKSTLLKLLLGLYKP  525 (709)
T ss_pred             EeCCCCEEEEECCCCCCHHHHHHHHhcCCCC
Confidence            4445678999999999999999999988887


No 440
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=80.22  E-value=1.1  Score=46.80  Aligned_cols=25  Identities=24%  Similarity=0.386  Sum_probs=20.8

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        30 Ge~~~i~G~nGsGKSTLl~~l~Gl~   54 (252)
T PRK14256         30 NSVTAIIGPSGCGKSTVLRSINRMH   54 (252)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhcc
Confidence            3458999999999999999886554


No 441
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=80.21  E-value=1.1  Score=47.84  Aligned_cols=26  Identities=31%  Similarity=0.373  Sum_probs=21.3

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        33 Ge~~~i~G~nGsGKSTLl~~l~Gl~~   58 (279)
T PRK13650         33 GEWLSIIGHNGSGKSTTVRLIDGLLE   58 (279)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            45689999999999999998864443


No 442
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=80.20  E-value=1.1  Score=46.12  Aligned_cols=26  Identities=27%  Similarity=0.515  Sum_probs=21.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        47 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   72 (224)
T cd03220          47 RGERIGLIGRNGAGKSTLLRLLAGIY   72 (224)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34568999999999999999775444


No 443
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=80.20  E-value=1.1  Score=47.26  Aligned_cols=27  Identities=30%  Similarity=0.268  Sum_probs=21.7

Q ss_pred             cceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      +.--.+.|+|..||||||++|-+-=++
T Consensus        35 ~~Ge~~~i~G~nGsGKSTLl~~l~Gl~   61 (265)
T PRK10575         35 PAGKVTGLIGHNGSGKSTLLKMLGRHQ   61 (265)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHcCCC
Confidence            345678999999999999999775444


No 444
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=80.18  E-value=1.2  Score=45.65  Aligned_cols=26  Identities=38%  Similarity=0.446  Sum_probs=21.3

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=+.
T Consensus        39 ~Ge~~~i~G~nGsGKSTLl~~l~Gl~   64 (226)
T cd03248          39 PGEVTALVGPSGSGKSTVVALLENFY   64 (226)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCc
Confidence            45678999999999999999775443


No 445
>PRK01184 hypothetical protein; Provisional
Probab=80.16  E-value=1.2  Score=43.96  Aligned_cols=20  Identities=35%  Similarity=0.468  Sum_probs=16.7

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      .|+|+|..+|||||+.+.++
T Consensus         3 ~i~l~G~~GsGKsT~a~~~~   22 (184)
T PRK01184          3 IIGVVGMPGSGKGEFSKIAR   22 (184)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            57899999999999876443


No 446
>KOG2355 consensus Predicted ABC-type transport, ATPase component/CCR4 associated factor [General function prediction only; Transcription]
Probab=80.15  E-value=1.1  Score=47.81  Aligned_cols=22  Identities=36%  Similarity=0.611  Sum_probs=18.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      .--+-||+|+.|+||||++|-+
T Consensus        39 ~gsRcLlVGaNGaGKtTlLKiL   60 (291)
T KOG2355|consen   39 AGSRCLLVGANGAGKTTLLKIL   60 (291)
T ss_pred             CCceEEEEecCCCchhhhHHHh
Confidence            3457899999999999999754


No 447
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=80.13  E-value=1.1  Score=43.23  Aligned_cols=25  Identities=32%  Similarity=0.365  Sum_probs=20.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      ---+.|+|..||||||+++-+-=++
T Consensus        26 Ge~~~i~G~nGsGKStLl~~l~G~~   50 (144)
T cd03221          26 GDRIGLVGRNGAGKSTLLKLIAGEL   50 (144)
T ss_pred             CCEEEEECCCCCCHHHHHHHHcCCC
Confidence            4567899999999999999774444


No 448
>PF06414 Zeta_toxin:  Zeta toxin;  InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein []. It has subsequently been found in a number of other proteins, such as polynucleotide kinase and 2',3'-cyclic-nucleotide 3'-phosphodiesterase. It appears to function as a kinase domain [, ].; GO: 0005524 ATP binding, 0016301 kinase activity; PDB: 2P5T_H 1GVN_B 3Q8X_D.
Probab=80.12  E-value=1.2  Score=45.07  Aligned_cols=28  Identities=25%  Similarity=0.395  Sum_probs=19.7

Q ss_pred             hcceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          528 RRTLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       528 ~k~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      +.+..=++|-|+.||||||+.+++.--+
T Consensus        12 ~~~P~~~i~aG~~GsGKSt~~~~~~~~~   39 (199)
T PF06414_consen   12 QEKPTLIIIAGQPGSGKSTLARQLLEEF   39 (199)
T ss_dssp             -SS-EEEEEES-TTSTTHHHHHHHHHHT
T ss_pred             ccCCEEEEEeCCCCCCHHHHHHHhhhhc
Confidence            3444556667999999999999987655


No 449
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=80.11  E-value=1.2  Score=42.04  Aligned_cols=38  Identities=11%  Similarity=0.113  Sum_probs=32.7

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCcc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDYD  783 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdYD  783 (819)
                      +++++||++|+ ...+..|..+|.+++++|||.++++-+
T Consensus        51 ~~~~i~D~~G~-~~~~~~~~~~~~~~~~~v~v~d~~~~~   88 (162)
T cd04106          51 VRLMLWDTAGQ-EEFDAITKAYYRGAQACILVFSTTDRE   88 (162)
T ss_pred             EEEEEeeCCch-HHHHHhHHHHhcCCCEEEEEEECCCHH
Confidence            78999999998 566777888999999999999988643


No 450
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=80.09  E-value=1.1  Score=46.24  Aligned_cols=25  Identities=24%  Similarity=0.174  Sum_probs=20.4

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        26 ~Ge~~~i~G~nGsGKSTLl~~l~Gl   50 (248)
T PRK09580         26 PGEVHAIMGPNGSGKSTLSATLAGR   50 (248)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHcCC
Confidence            3557899999999999999876433


No 451
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=80.07  E-value=1.2  Score=46.78  Aligned_cols=20  Identities=30%  Similarity=0.551  Sum_probs=18.7

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      |++|+|..++||||+++++.
T Consensus         2 ~v~lvG~~~~GKStLl~~Lt   21 (233)
T cd01896           2 RVALVGFPSVGKSTLLSKLT   21 (233)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            78999999999999999885


No 452
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=80.01  E-value=1.2  Score=45.57  Aligned_cols=26  Identities=27%  Similarity=0.323  Sum_probs=21.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   50 (223)
T TIGR03740        25 KNSVYGLLGPNGAGKSTLLKMITGIL   50 (223)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCC
Confidence            35578999999999999999775443


No 453
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family. Type I protein secretion is a system in some Gram-negative bacteria to export proteins (often proteases) across both inner and outer membranes to the extracellular medium. This is one of three proteins of the type I secretion apparatus. Targeted proteins are not cleaved at the N-terminus, but rather carry signals located toward the extreme C-terminus to direct type I secretion. This model is related to models TIGR01842 and TIGR01846, and to bacteriocin ABC transporters that cleave their substrates during export.
Probab=79.95  E-value=1.7  Score=52.09  Aligned_cols=29  Identities=38%  Similarity=0.539  Sum_probs=24.6

Q ss_pred             cceeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +.--|+.++|..||||||++|-+-=+|.|
T Consensus       489 ~~G~~iaIvG~sGsGKSTLlklL~gl~~p  517 (694)
T TIGR03375       489 RPGEKVAIIGRIGSGKSTLLKLLLGLYQP  517 (694)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHhcCCCC
Confidence            34568999999999999999998777765


No 454
>PRK08356 hypothetical protein; Provisional
Probab=79.95  E-value=1.2  Score=44.99  Aligned_cols=20  Identities=25%  Similarity=0.253  Sum_probs=18.2

Q ss_pred             eEEEeecCCCCchhHHHHHH
Q 003444          533 KLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMK  552 (819)
                      -++|+|+.+|||||+.++++
T Consensus         7 ~i~~~G~~gsGK~t~a~~l~   26 (195)
T PRK08356          7 IVGVVGKIAAGKTTVAKFFE   26 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHH
Confidence            47889999999999999995


No 455
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.93  E-value=1.2  Score=46.82  Aligned_cols=24  Identities=29%  Similarity=0.481  Sum_probs=19.7

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        38 Ge~~~l~G~nGsGKSTLl~~l~G~   61 (259)
T PRK14274         38 NEVTAIIGPSGCGKSTFIKTLNLM   61 (259)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhh
Confidence            345889999999999999987533


No 456
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.93  E-value=1.2  Score=46.89  Aligned_cols=26  Identities=27%  Similarity=0.367  Sum_probs=21.2

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        33 Ge~~~l~G~nGsGKSTLlk~l~Gl~~   58 (259)
T PRK14260         33 NKVTAIIGPSGCGKSTFIKTLNRISE   58 (259)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhhcC
Confidence            45688999999999999998854443


No 457
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=79.89  E-value=1.2  Score=45.32  Aligned_cols=20  Identities=25%  Similarity=0.576  Sum_probs=18.4

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      +||++||..++|||||+.++
T Consensus         1 ~kI~ivG~~~vGKTsLi~~~   20 (198)
T cd04142           1 VRVAVLGAPGVGKTAIVRQF   20 (198)
T ss_pred             CEEEEECCCCCcHHHHHHHH
Confidence            58999999999999999875


No 458
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional
Probab=79.85  E-value=1.6  Score=51.27  Aligned_cols=31  Identities=26%  Similarity=0.471  Sum_probs=25.7

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHHHHhcC
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAKILYKA  557 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMKILy~p  557 (819)
                      +-+.--+++++|.+||||||++|-+-=+|.|
T Consensus       357 ~i~~G~~v~IvG~sGsGKSTLl~lL~gl~~p  387 (588)
T PRK13657        357 EAKPGQTVAIVGPTGAGKSTLINLLQRVFDP  387 (588)
T ss_pred             EECCCCEEEEECCCCCCHHHHHHHHhcCcCC
Confidence            3344678999999999999999999777765


No 459
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=79.85  E-value=1.1  Score=45.41  Aligned_cols=26  Identities=31%  Similarity=0.372  Sum_probs=20.7

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        30 Ge~~~i~G~nGsGKSTLl~~l~G~~~   55 (221)
T cd03244          30 GEKVGIVGRTGSGKSSLLLALFRLVE   55 (221)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHcCCC
Confidence            34588999999999999998754443


No 460
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=79.84  E-value=1.3  Score=45.57  Aligned_cols=20  Identities=35%  Similarity=0.600  Sum_probs=18.2

Q ss_pred             eeEEEeecCCCCchhHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQM  551 (819)
                      ++|||||..||||||+..-+
T Consensus         1 l~IlllG~tGsGKSs~~N~i   20 (212)
T PF04548_consen    1 LRILLLGKTGSGKSSLGNSI   20 (212)
T ss_dssp             EEEEEECSTTSSHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHH
Confidence            58999999999999998876


No 461
>PRK14529 adenylate kinase; Provisional
Probab=79.83  E-value=1.4  Score=46.54  Aligned_cols=25  Identities=32%  Similarity=0.409  Sum_probs=21.0

Q ss_pred             eeEEEeecCCCCchhHHHHHHHHhc
Q 003444          532 QKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .+|+|+|+.||||||+.+.+.-.|+
T Consensus         1 m~I~l~G~PGsGK~T~a~~La~~~~   25 (223)
T PRK14529          1 MNILIFGPNGSGKGTQGALVKKKYD   25 (223)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHC
Confidence            3799999999999999988765554


No 462
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=79.83  E-value=1.2  Score=43.43  Aligned_cols=22  Identities=41%  Similarity=0.501  Sum_probs=18.6

Q ss_pred             EEEeecCCCCchhHHHHHHHHh
Q 003444          534 LLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy  555 (819)
                      +++.|..+|||||+.+++.-..
T Consensus         2 i~i~G~~GsGKSTla~~L~~~l   23 (149)
T cd02027           2 IWLTGLSGSGKSTIARALEEKL   23 (149)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHH
Confidence            6789999999999999885443


No 463
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.82  E-value=1.2  Score=47.57  Aligned_cols=25  Identities=24%  Similarity=0.433  Sum_probs=20.4

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        45 ~Ge~~~IiG~nGsGKSTLl~~l~Gl   69 (274)
T PRK14265         45 AKKIIAFIGPSGCGKSTLLRCFNRM   69 (274)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcc
Confidence            3446889999999999999987533


No 464
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=79.80  E-value=1.2  Score=45.27  Aligned_cols=26  Identities=31%  Similarity=0.388  Sum_probs=21.4

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        33 Ge~~~i~G~nGsGKSTLl~~l~G~~~   58 (202)
T cd03233          33 GEMVLVLGRPGSGCSTLLKALANRTE   58 (202)
T ss_pred             CcEEEEECCCCCCHHHHHHHhcccCC
Confidence            45789999999999999998755543


No 465
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=79.77  E-value=1.2  Score=47.78  Aligned_cols=25  Identities=28%  Similarity=0.405  Sum_probs=20.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        37 Ge~~~l~G~nGsGKSTLl~~l~Gl~   61 (289)
T PRK13645         37 NKVTCVIGTTGSGKSTMIQLTNGLI   61 (289)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCC
Confidence            3468999999999999999875443


No 466
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=79.77  E-value=1.2  Score=45.48  Aligned_cols=25  Identities=28%  Similarity=0.255  Sum_probs=20.5

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        26 ~Ge~~~i~G~nGsGKSTLl~~i~G~   50 (218)
T cd03290          26 TGQLTMIVGQVGCGKSSLLLAILGE   50 (218)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcc
Confidence            3457899999999999999876533


No 467
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]
Probab=79.74  E-value=1.9  Score=48.53  Aligned_cols=36  Identities=28%  Similarity=0.494  Sum_probs=28.8

Q ss_pred             EEEeecCCCCchhHHHHHHHHhcC------------CCCCHHHhhhhH
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYKA------------VPFSDDEHENIK  569 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~p------------~GFS~eEr~~~K  569 (819)
                      +.++|-+||||||+++-+.-|..|            ...+..++..+|
T Consensus        57 fViMGLSGSGKSTLvR~~NrLiept~G~ilv~g~di~~~~~~~Lr~~R  104 (386)
T COG4175          57 FVIMGLSGSGKSTLVRLLNRLIEPTRGEILVDGKDIAKLSAAELRELR  104 (386)
T ss_pred             EEEEecCCCCHHHHHHHHhccCCCCCceEEECCcchhcCCHHHHHHHH
Confidence            467899999999999999877665            236677877766


No 468
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=79.69  E-value=1.2  Score=44.95  Aligned_cols=26  Identities=27%  Similarity=0.350  Sum_probs=21.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        25 ~Ge~~~i~G~nGsGKSTLl~~l~G~~   50 (201)
T cd03231          25 AGEALQVTGPNGSGKTTLLRILAGLS   50 (201)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            45678999999999999999775443


No 469
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=79.67  E-value=1.1  Score=48.34  Aligned_cols=25  Identities=20%  Similarity=0.324  Sum_probs=20.3

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|+.||||||++|-+-=+.
T Consensus        19 Ge~~~l~G~NGaGKSTLl~~l~Gl~   43 (302)
T TIGR01188        19 GEVFGFLGPNGAGKTTTIRMLTTLL   43 (302)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            3467899999999999999875443


No 470
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=79.67  E-value=1.3  Score=40.63  Aligned_cols=23  Identities=30%  Similarity=0.462  Sum_probs=17.9

Q ss_pred             eEEEeecCCCCchhHHHHHHHHh
Q 003444          533 KLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       533 KLLLLGaGESGKSTIlKQMKILy  555 (819)
                      =+++.|..|+||||+++++.--+
T Consensus         6 ~~~i~G~~G~GKT~~~~~~~~~~   28 (131)
T PF13401_consen    6 ILVISGPPGSGKTTLIKRLARQL   28 (131)
T ss_dssp             -EEEEE-TTSSHHHHHHHHHHHH
T ss_pred             ccEEEcCCCCCHHHHHHHHHHHh
Confidence            36789999999999999886544


No 471
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=79.65  E-value=1.2  Score=47.80  Aligned_cols=27  Identities=33%  Similarity=0.474  Sum_probs=22.1

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        32 ~Ge~~~i~G~nGsGKSTLl~~L~Gl~~   58 (286)
T PRK13646         32 QGKYYAIVGQTGSGKSTLIQNINALLK   58 (286)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            345789999999999999998865543


No 472
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=79.62  E-value=1.2  Score=47.00  Aligned_cols=25  Identities=32%  Similarity=0.384  Sum_probs=20.4

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        29 ~Ge~~~I~G~NGsGKSTLl~~i~Gl   53 (251)
T PRK09544         29 PGKILTLLGPNGAGKSTLVRVVLGL   53 (251)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCC
Confidence            3457899999999999999976533


No 473
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=79.61  E-value=1.2  Score=47.34  Aligned_cols=25  Identities=32%  Similarity=0.344  Sum_probs=20.3

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        33 Ge~~~l~G~nGsGKSTLl~~i~Gl~   57 (280)
T PRK13649         33 GSYTAFIGHTGSGKSTIMQLLNGLH   57 (280)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            4468899999999999999775443


No 474
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=79.61  E-value=1.3  Score=45.60  Aligned_cols=37  Identities=11%  Similarity=0.157  Sum_probs=32.5

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCCc
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSDY  782 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSdY  782 (819)
                      +.+++||++|+ ...+..|..+|.+++++|+|.|+++-
T Consensus        54 ~~l~IwDtaG~-e~~~~l~~~~yr~ad~iIlVyDvtn~   90 (202)
T cd04102          54 FFVELWDVGGS-ESVKSTRAVFYNQVNGIILVHDLTNR   90 (202)
T ss_pred             EEEEEEecCCc-hhHHHHHHHHhCcCCEEEEEEECcCh
Confidence            78999999998 56677788899999999999999864


No 475
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=79.61  E-value=1.1  Score=48.02  Aligned_cols=22  Identities=32%  Similarity=0.514  Sum_probs=18.9

Q ss_pred             EEeecCCCCchhHHHHHHHHhc
Q 003444          535 LLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       535 LLLGaGESGKSTIlKQMKILy~  556 (819)
                      -|+|++||||||++|-+..++.
T Consensus        37 AlIGPSGcGKST~LR~lNRmnd   58 (253)
T COG1117          37 ALIGPSGCGKSTLLRCLNRMND   58 (253)
T ss_pred             EEECCCCcCHHHHHHHHHhhcc
Confidence            5889999999999998876654


No 476
>KOG1673 consensus Ras GTPases [General function prediction only]
Probab=79.60  E-value=1.6  Score=44.62  Aligned_cols=36  Identities=14%  Similarity=0.219  Sum_probs=26.3

Q ss_pred             cccEEEEEeccccccccccccc-ccCCCCEEEEEEeCCC
Q 003444          744 LLRYQLIRVQARGLGENCKWLE-MFEDIGMVIFCVALSD  781 (819)
Q Consensus       744 ~l~frLiDVGGQgrsERkKWi~-~FEdVtaVIFvVSLSd  781 (819)
                      .+.|.+||+||| + +-+.-+. .-.|.-+|+|+.||+.
T Consensus        68 ~IsfSIwdlgG~-~-~~~n~lPiac~dsvaIlFmFDLt~  104 (205)
T KOG1673|consen   68 DISFSIWDLGGQ-R-EFINMLPIACKDSVAILFMFDLTR  104 (205)
T ss_pred             EEEEEEEecCCc-H-hhhccCceeecCcEEEEEEEecCc
Confidence            389999999999 3 3333333 2357789999999984


No 477
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=79.59  E-value=1.2  Score=47.32  Aligned_cols=25  Identities=28%  Similarity=0.369  Sum_probs=20.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        49 ~Ge~~~I~G~nGsGKSTLl~~i~Gl   73 (271)
T PRK14238         49 ENEVTAIIGPSGCGKSTYIKTLNRM   73 (271)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHhh
Confidence            3457889999999999999988533


No 478
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=79.57  E-value=1.1  Score=48.16  Aligned_cols=27  Identities=26%  Similarity=0.455  Sum_probs=22.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|+.||||||++|-+-=+..
T Consensus        32 ~Ge~~~i~G~nGsGKSTLl~~l~Gl~~   58 (290)
T PRK13634         32 SGSYVAIIGHTGSGKSTLLQHLNGLLQ   58 (290)
T ss_pred             CCCEEEEECCCCCcHHHHHHHHhcCCC
Confidence            345789999999999999998865543


No 479
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=79.57  E-value=2.4  Score=40.61  Aligned_cols=36  Identities=6%  Similarity=-0.085  Sum_probs=30.8

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      ..+++||++|+ ...+..|..++.+++++|+|.|+++
T Consensus        49 ~~l~i~Dt~G~-~~~~~~~~~~~~~~~~~ilv~d~~~   84 (165)
T cd04140          49 CTLQITDTTGS-HQFPAMQRLSISKGHAFILVYSVTS   84 (165)
T ss_pred             EEEEEEECCCC-CcchHHHHHHhhcCCEEEEEEECCC
Confidence            67899999998 5666677778899999999999875


No 480
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=79.57  E-value=1.3  Score=46.75  Aligned_cols=22  Identities=27%  Similarity=0.377  Sum_probs=20.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQA  551 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQM  551 (819)
                      ..+||+|||.+++|||+|++++
T Consensus        12 ~~~KIvvvGd~~VGKTsLi~r~   33 (232)
T cd04174          12 MRCKLVLVGDVQCGKTAMLQVL   33 (232)
T ss_pred             eeEEEEEECCCCCcHHHHHHHH
Confidence            4689999999999999999875


No 481
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=79.56  E-value=1.3  Score=44.86  Aligned_cols=27  Identities=26%  Similarity=0.353  Sum_probs=21.6

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .--.+.|+|..||||||++|-+-=++.
T Consensus        33 ~G~~~~i~G~nGsGKSTLl~~l~Gl~~   59 (207)
T cd03369          33 AGEKIGIVGRTGAGKSTLILALFRFLE   59 (207)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcccC
Confidence            345689999999999999998854443


No 482
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=79.48  E-value=1.2  Score=46.53  Aligned_cols=26  Identities=35%  Similarity=0.374  Sum_probs=21.0

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHHh
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      .--.+.|+|..||||||++|-+-=++
T Consensus        27 ~Ge~~~l~G~nGsGKSTLl~~l~Gl~   52 (255)
T PRK11231         27 TGKITALIGPNGCGKSTLLKCFARLL   52 (255)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCc
Confidence            34468999999999999999885444


No 483
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.43  E-value=1.2  Score=46.20  Aligned_cols=25  Identities=24%  Similarity=0.432  Sum_probs=20.2

Q ss_pred             ceeeEEEeecCCCCchhHHHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      .--.+.|+|..||||||++|-+-=+
T Consensus        28 ~Ge~~~i~G~nGsGKSTLl~~i~Gl   52 (250)
T PRK14262         28 KNQITAIIGPSGCGKTTLLRSINRM   52 (250)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcc
Confidence            3456899999999999999976533


No 484
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]
Probab=79.42  E-value=1.9  Score=51.05  Aligned_cols=30  Identities=27%  Similarity=0.352  Sum_probs=24.3

Q ss_pred             HhcceeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          527 ERRTLQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       527 ~~k~~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      .-+.--|+-+||.+||||||+++.+.-.|.
T Consensus       360 ~l~~GEkvAIlG~SGsGKSTllqLl~~~~~  389 (573)
T COG4987         360 TLAQGEKVAILGRSGSGKSTLLQLLAGAWD  389 (573)
T ss_pred             eecCCCeEEEECCCCCCHHHHHHHHHhccC
Confidence            344567999999999999999999985443


No 485
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=79.38  E-value=1.3  Score=45.46  Aligned_cols=21  Identities=24%  Similarity=0.409  Sum_probs=18.7

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      .|+.|+|..||||||+++.+-
T Consensus         2 ~~i~i~G~~GsGKTTll~~l~   22 (199)
T TIGR00101         2 LKIGVAGPVGSGKTALIEALT   22 (199)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            588999999999999998764


No 486
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=79.36  E-value=1.3  Score=45.47  Aligned_cols=21  Identities=14%  Similarity=0.613  Sum_probs=18.8

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.|++||.+++|||||++++.
T Consensus         1 ~~vvvlG~~gVGKTSli~r~~   21 (202)
T cd04120           1 LQVIIIGSRGVGKTSLMRRFT   21 (202)
T ss_pred             CEEEEECcCCCCHHHHHHHHH
Confidence            368999999999999999974


No 487
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=79.36  E-value=1.5  Score=42.40  Aligned_cols=23  Identities=17%  Similarity=0.332  Sum_probs=20.7

Q ss_pred             ceeeEEEeecCCCCchhHHHHHH
Q 003444          530 TLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       530 ~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.+++.++|..+.||||+++.|.
T Consensus       101 ~~~~v~~~G~~nvGKStliN~l~  123 (157)
T cd01858         101 KQISVGFIGYPNVGKSSIINTLR  123 (157)
T ss_pred             cceEEEEEeCCCCChHHHHHHHh
Confidence            46789999999999999999984


No 488
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.35  E-value=1.2  Score=46.81  Aligned_cols=25  Identities=28%  Similarity=0.332  Sum_probs=20.5

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        38 Ge~~~i~G~nGsGKSTLl~~i~Gl~   62 (258)
T PRK14268         38 NSVTALIGPSGCGKSTFIRCLNRMN   62 (258)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCC
Confidence            3458899999999999999886443


No 489
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=79.24  E-value=1.3  Score=46.12  Aligned_cols=24  Identities=29%  Similarity=0.307  Sum_probs=19.9

Q ss_pred             cceeeEEEeecCCCCchhHHHHHH
Q 003444          529 RTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       529 k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +.--.+.|+|..||||||++|-+-
T Consensus        31 ~~Ge~~~i~G~nGsGKSTLl~~i~   54 (252)
T CHL00131         31 NKGEIHAIMGPNGSGKSTLSKVIA   54 (252)
T ss_pred             cCCcEEEEECCCCCCHHHHHHHHc
Confidence            345678999999999999998653


No 490
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=79.11  E-value=2  Score=43.31  Aligned_cols=27  Identities=26%  Similarity=0.357  Sum_probs=20.8

Q ss_pred             EEEeecCCCCchhHHHHHHHHhcCCCC
Q 003444          534 LLLVGCSGSGTSTIFKQAKILYKAVPF  560 (819)
Q Consensus       534 LLLLGaGESGKSTIlKQMKILy~p~GF  560 (819)
                      |.+-|+++||||||.+++.-+.+..++
T Consensus         2 IgI~G~sgSGKTTla~~L~~~L~~~~~   28 (194)
T PF00485_consen    2 IGIAGPSGSGKTTLAKRLAQILNKRGI   28 (194)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHHTTCTT
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCccCc
Confidence            457799999999999999765542444


No 491
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=79.06  E-value=1.3  Score=47.73  Aligned_cols=25  Identities=32%  Similarity=0.416  Sum_probs=21.0

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-|-=+.
T Consensus        33 Ge~~~i~G~nGaGKSTLl~~l~Gl~   57 (287)
T PRK13637         33 GEFVGLIGHTGSGKSTLIQHLNGLL   57 (287)
T ss_pred             CCEEEEECCCCCcHHHHHHHHhcCC
Confidence            4578999999999999999886444


No 492
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=79.06  E-value=1.4  Score=46.24  Aligned_cols=21  Identities=19%  Similarity=0.403  Sum_probs=19.5

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      +||+|||.+++|||+|+.++.
T Consensus         2 ~KIvvvGd~~vGKTsLi~~~~   22 (222)
T cd04173           2 CKIVVVGDAECGKTALLQVFA   22 (222)
T ss_pred             eEEEEECCCCCCHHHHHHHHH
Confidence            799999999999999999874


No 493
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.04  E-value=1.3  Score=46.10  Aligned_cols=24  Identities=29%  Similarity=0.426  Sum_probs=20.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKIL  554 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKIL  554 (819)
                      --.+.|+|..||||||++|-+-=+
T Consensus        28 Ge~~~i~G~nGsGKSTLl~~l~Gl   51 (246)
T PRK14269         28 NKITALIGASGCGKSTFLRCFNRM   51 (246)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcc
Confidence            456899999999999999987544


No 494
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=79.04  E-value=1.3  Score=46.25  Aligned_cols=22  Identities=32%  Similarity=0.437  Sum_probs=19.1

Q ss_pred             eeeEEEeecCCCCchhHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --.+.|+|..||||||++|-+-
T Consensus        32 Ge~~~i~G~nGsGKSTLl~~l~   53 (253)
T PRK14261         32 NRVTALIGPSGCGKSTLLRCFN   53 (253)
T ss_pred             CcEEEEECCCCCCHHHHHHHHh
Confidence            3458999999999999999884


No 495
>PRK06547 hypothetical protein; Provisional
Probab=79.03  E-value=1.6  Score=44.06  Aligned_cols=27  Identities=26%  Similarity=0.336  Sum_probs=21.7

Q ss_pred             HHhcceeeEEEeecCCCCchhHHHHHH
Q 003444          526 IERRTLQKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       526 ~~~k~~vKLLLLGaGESGKSTIlKQMK  552 (819)
                      ....+...+++.|..||||||+.+.+.
T Consensus        10 ~~~~~~~~i~i~G~~GsGKTt~a~~l~   36 (172)
T PRK06547         10 LCGGGMITVLIDGRSGSGKTTLAGALA   36 (172)
T ss_pred             hhcCCCEEEEEECCCCCCHHHHHHHHH
Confidence            445566778888999999999998873


No 496
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=78.99  E-value=1.2  Score=46.26  Aligned_cols=23  Identities=30%  Similarity=0.381  Sum_probs=19.6

Q ss_pred             eeeEEEeecCCCCchhHHHHHHH
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKI  553 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKI  553 (819)
                      --.+.|+|..||||||++|-+-=
T Consensus        31 Ge~~~l~G~nGsGKSTLl~~l~G   53 (252)
T PRK14255         31 NEITALIGPSGCGKSTYLRTLNR   53 (252)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhc
Confidence            44689999999999999998853


No 497
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=78.99  E-value=2.4  Score=40.01  Aligned_cols=36  Identities=6%  Similarity=0.129  Sum_probs=29.0

Q ss_pred             ccEEEEEecccccccccccccccCCCCEEEEEEeCCC
Q 003444          745 LRYQLIRVQARGLGENCKWLEMFEDIGMVIFCVALSD  781 (819)
Q Consensus       745 l~frLiDVGGQgrsERkKWi~~FEdVtaVIFvVSLSd  781 (819)
                      +.+++||++|+ ......+..++.+++++|+|.|+++
T Consensus        48 ~~l~i~D~~g~-~~~~~~~~~~~~~~~~~ii~fd~~~   83 (162)
T PF00071_consen   48 VNLEIWDTSGQ-ERFDSLRDIFYRNSDAIIIVFDVTD   83 (162)
T ss_dssp             EEEEEEEETTS-GGGHHHHHHHHTTESEEEEEEETTB
T ss_pred             ccccccccccc-ccccccccccccccccccccccccc
Confidence            78999999997 3334445668999999999999875


No 498
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=78.97  E-value=1.4  Score=45.43  Aligned_cols=21  Identities=48%  Similarity=0.732  Sum_probs=17.2

Q ss_pred             eeEEEeecCCCCchhHHHHHH
Q 003444          532 QKLLLVGCSGSGTSTIFKQAK  552 (819)
Q Consensus       532 vKLLLLGaGESGKSTIlKQMK  552 (819)
                      --+||+|+.+||||++|-|+.
T Consensus         4 ~~vlL~Gps~SGKTaLf~~L~   24 (181)
T PF09439_consen    4 PTVLLVGPSGSGKTALFSQLV   24 (181)
T ss_dssp             -EEEEE-STTSSHHHHHHHHH
T ss_pred             ceEEEEcCCCCCHHHHHHHHh
Confidence            358999999999999998875


No 499
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=78.94  E-value=1.3  Score=46.89  Aligned_cols=25  Identities=24%  Similarity=0.328  Sum_probs=20.7

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHh
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILY  555 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy  555 (819)
                      --.+.|+|..||||||++|-+-=++
T Consensus        45 Ge~~~i~G~nGsGKSTLl~~l~Gl~   69 (267)
T PRK14235         45 KTVTAFIGPSGCGKSTFLRCLNRMN   69 (267)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhhc
Confidence            4457899999999999999885444


No 500
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=78.93  E-value=1.2  Score=47.18  Aligned_cols=26  Identities=31%  Similarity=0.489  Sum_probs=20.9

Q ss_pred             eeeEEEeecCCCCchhHHHHHHHHhc
Q 003444          531 LQKLLLVGCSGSGTSTIFKQAKILYK  556 (819)
Q Consensus       531 ~vKLLLLGaGESGKSTIlKQMKILy~  556 (819)
                      --.+.|+|..||||||++|-+-=++.
T Consensus        50 Ge~~~l~G~nGsGKSTLl~~L~Gl~~   75 (269)
T cd03294          50 GEIFVIMGLSGSGKSTLLRCINRLIE   75 (269)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            45678999999999999997754443


Done!