Citrus Sinensis ID: 003499


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-----
MADPSSSAPRPASSSDPKSSKKDYSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSTGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIERERRKRENPEAMEEDEVDDVAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRFADRTESAAAGAADPFSSATAAAADDDDLYN
cccccccccccccccccccccccccHHHHHcccccccEEEcccccccccEEEEcHHHHHHcccccccEEEEEEccccEEEEEEcccccccccEEEEcHHHHHHcccccccEEEEEEccccccccEEEEcccccccccccccHHHHHHHHHHHHcccccccccEEEEEcccEEEEEEEEEccccccEEEcccccEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHccccccccEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccccEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccHHHHHHccccccEEEEEccccccccEEEEcHHHHHHcccccccEEEEEccccEEEEEEEcccccccccEEEEccEHHHccccccccEEEEEEccccccccEEEEEcccccEEcccccHHHHHHHHHHHHHccccccccEEEEEcccEEEEEEEEEEccccEEEEccccEEEEcccccccccccccccccHccccHHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHccccEEEEccHHHccccHcccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccHHHcccccccEEEEccccccccHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHccccHHHHHHHHHcccccHHcEEEEEcccccHcccccHHHHHHHHHHHHccccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHccccEEEEccHHHHHHHHcHcHHHHHHHHHHHHHcccEEEEEcHHHHHcHHccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHHccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHcccccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc
madpsssaprpasssdpksskkdySTAIldrkkspnrlvvdeainddnsvitmhpntmeklqffrgdtvlvkgkkrkdtVCVVLSDELCEASKVRVNKVVRSNLRvrlgdvvsvhpcpdvkygrrvhilpiddtiegvtgnlfdaylkpyfmesyrpvrkgdlflvrggmrsvefkvietdpgeycvvapdteifcegepvkredeerlnevgyddvggVRKQMAQIRELVElplrhpqlfksigvkppkgillygppgsgkTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAeknapsiifideldsiapkrekthgeVERRIVSQLLTLMDGLKSRAHVIVMgatnrpnsidpalrrfgrfdreidigvpdevgRLEILRIHTKNmklaedvdlervakdthgyvgsDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQtalgtsnpsaLRETVVevpnvswediggldNVKRELQETvqypvehpekfekfgmspskgvlfygppgcgkTLLAKAIANECQanfisvkgpelltmwfgesEANVREIFDKArqsapcvlffDELDSIatqrgsstgdaggAADRVLNQLLTEMDGMNAKKTVFIIGatnrpdiidpallrpgrldqliyiplpdeASRLQIFKAClrkspispdvdlsalarythgfsgadITEVCQRACKYAIRENIEKDIERERrkrenpeameedevdDVAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQsrgfgsefrfadrtesaaagaadpfssataaaaddddlyn
madpsssaprpasssdpksskkdystaildrkkspnrlvvdeainddnsvitmhPNTMEKLQFfrgdtvlvkgkkrKDTVCVVlsdelceaskvrvnkvvrsnlrvrlgdvvsvhpcpdvkygrrvhilpiddtiegvTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSvefkvietdpgeycvvapdteifcegepvkredeerlnevgyddvggvRKQMAQIRELVElplrhpqlfksigvkppkgILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAeknapsiifideldsiapkrekthgeverrIVSQLLTLMDGLKSRAHVIVmgatnrpnsidpalrrfgrfdreidigvpdevgrleILRIHtknmklaedvdLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTalgtsnpsaLRETVVEVPnvswediggldNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQrgsstgdaggaADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIreniekdiererrkrenpeameedevddvAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRFADRTESaaagaadpfssataaaaddddlyn
MadpsssaprpasssdpksskkdYSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSTgdaggaadRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAireniekdiererrkrenPeameedevddvaeikavHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRFADRTEsaaagaadpfssataaaaddddLYN
**************************************VVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGE**********NEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIM************************IIFIDELDSI**********VERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVE****FEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIA**************DRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENI*****************************AVHF************DADIRKYQLFAQTL******************************************
************************************RLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDT***VTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFC****************GYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDS*****************SQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMD***********EVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDS******************VLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIE**************DEVDDVAEIKAVHFEESMKYARRSVSDADIRKYQLF*******************************************LYN
*************************TAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPK********ERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ********GGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIER****************DDVAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRFADRTESAAAGAADPFSSATAAAADDDDLYN
**********************DYSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQR********GAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIERERRK***********VDDVAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQSR**************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADPSSSAPRPASSSDPKSSKKDYSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSTGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIERERRKRENPEAMEEDEVDDVAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRFADRTESAAAGAADPFSSATAAAADDDDLYN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query815 2.2.26 [Sep-21-2011]
P54774807 Cell division cycle prote no no 0.981 0.991 0.910 0.0
Q96372805 Cell division cycle prote N/A no 0.982 0.995 0.894 0.0
Q9LZF6810 Cell division control pro yes no 0.968 0.974 0.896 0.0
P54609809 Cell division control pro yes no 0.986 0.993 0.897 0.0
Q9SCN8815 Cell division control pro no no 0.984 0.984 0.874 0.0
P23787805 Transitional endoplasmic N/A no 0.946 0.957 0.790 0.0
Q7ZU99806 Transitional endoplasmic yes no 0.946 0.956 0.798 0.0
Q6GL04805 Transitional endoplasmic yes no 0.946 0.957 0.792 0.0
Q01853806 Transitional endoplasmic yes no 0.946 0.956 0.792 0.0
P55072806 Transitional endoplasmic yes no 0.946 0.956 0.792 0.0
>sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 Back     alignment and function desciption
 Score = 1516 bits (3925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/803 (91%), Positives = 772/803 (96%), Gaps = 3/803 (0%)

Query: 14  SSDPKSSKKDYSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKG 73
           SSDPKS KKD+STAIL+RKKSPNRLVVDEA+NDDNSV+TMHP TMEKLQ FRGDT+L+KG
Sbjct: 7   SSDPKSGKKDFSTAILERKKSPNRLVVDEAVNDDNSVVTMHPQTMEKLQLFRGDTILIKG 66

Query: 74  KKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDD 133
           KKRKDT+C+ L+DE CE  K+R+NKVVRSNLRVRLGDVVSVH CPDVKYG+RVHILPIDD
Sbjct: 67  KKRKDTICIALADENCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVHILPIDD 126

Query: 134 TIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTE 193
           TIEGVTGNLFDA+LKPYF+E+YRPVRKGDLFLVRGGMRSVEFKV+ETDPGEYCVVAPDTE
Sbjct: 127 TIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVVETDPGEYCVVAPDTE 186

Query: 194 IFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGIL 253
           IFCEGEP+KREDEERL+EVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGIL
Sbjct: 187 IFCEGEPLKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGIL 246

Query: 254 LYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIF 313
           LYGPPGSGKTLIARAVANETGAFFF INGPEIMSKLAGESESNLRKAFEEAEKNAPSIIF
Sbjct: 247 LYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIF 306

Query: 314 IDELDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGR 373
           IDE+DSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIV+GATNRPNSIDPALRRFGR
Sbjct: 307 IDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGR 366

Query: 374 FDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQC 433
           FDREIDIGVPDEVGRLE+LRIHTKNMKL++DVDLER+AKDTHGYVG+DLAALCTEAALQC
Sbjct: 367 FDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQC 426

Query: 434 IREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGL 493
           IREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGL
Sbjct: 427 IREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGL 486

Query: 494 DNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISV 553
           +NVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISV
Sbjct: 487 ENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISV 546

Query: 554 KGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSTGDAGGAADRVLN 613
           KGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSS GDAGGAADRVLN
Sbjct: 547 KGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSVGDAGGAADRVLN 606

Query: 614 QLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLR 673
           QLLTEMDGM+AKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDE SR QIFKACLR
Sbjct: 607 QLLTEMDGMSAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEDSRHQIFKACLR 666

Query: 674 KSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIERERRKRENPEAMEE 733
           KSPI+ +VDL ALAR+T GFSGADITE+CQRACKYAIRENIEKDIERER+ RENPEAM+E
Sbjct: 667 KSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDE 726

Query: 734 DEVDD-VAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRFADRTESA 792
           D VDD VAEIKA HFEESMK+ARRSVSDADIRKYQ FAQTLQQSRGFGSEFRF +  +  
Sbjct: 727 DTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRT 786

Query: 793 AAGAADPFSSATAAAADDDDLYN 815
             G +DPF +A+A  AD+DDLY+
Sbjct: 787 TTG-SDPF-AASAGGADEDDLYS 807




Probably functions in cell division and growth processes.
Glycine max (taxid: 3847)
>sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 Back     alignment and function description
>sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 Back     alignment and function description
>sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 Back     alignment and function description
>sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 Back     alignment and function description
>sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 Back     alignment and function description
>sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 Back     alignment and function description
>sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 Back     alignment and function description
>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 Back     alignment and function description
>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
356508699814 PREDICTED: cell division cycle protein 4 0.997 0.998 0.909 0.0
356518956814 PREDICTED: cell division cycle protein 4 0.997 0.998 0.909 0.0
449440656819 PREDICTED: cell division cycle protein 4 0.998 0.993 0.901 0.0
224121826799 predicted protein [Populus trichocarpa] 0.977 0.997 0.928 0.0
224133614813 predicted protein [Populus trichocarpa] 0.981 0.984 0.927 0.0
225456951814 PREDICTED: cell division cycle protein 4 0.963 0.964 0.936 0.0
356505246808 PREDICTED: cell division cycle protein 4 0.981 0.990 0.907 0.0
147782460802 hypothetical protein VITISV_038729 [Viti 0.963 0.978 0.936 0.0
351727028807 cell division cycle protein 48 homolog [ 0.981 0.991 0.910 0.0
255556938805 Transitional endoplasmic reticulum ATPas 0.980 0.992 0.910 0.0
>gi|356508699|ref|XP_003523092.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] Back     alignment and taxonomy information
 Score = 1544 bits (3998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 742/816 (90%), Positives = 789/816 (96%), Gaps = 3/816 (0%)

Query: 1   MADPSSSAP-RPASSSDPKSSKKDYSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTME 59
           MADP+SS P +  SS++PKS KKDYSTAIL+RKKSPNRLVVDEAIND+NSV+T+HP TME
Sbjct: 1   MADPTSSNPDKDQSSTEPKSEKKDYSTAILERKKSPNRLVVDEAINDENSVVTLHPETME 60

Query: 60  KLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPD 119
           KLQFFRGDTVL+KGKKR+DT+CVVL+DE C+  K+R+NKVVR+NLRVRLGDVVSVH CPD
Sbjct: 61  KLQFFRGDTVLIKGKKRRDTICVVLADEQCDEPKIRMNKVVRANLRVRLGDVVSVHQCPD 120

Query: 120 VKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIE 179
           VKYG+RVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRS+EFK+IE
Sbjct: 121 VKYGKRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSIEFKLIE 180

Query: 180 TDPGEYCVVAPDTEIFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQ 239
           TDPGEYCVVAPDTEIFCEGEP+KREDEERLN+VGYDDVGGVRKQMAQIRELVELPLRHPQ
Sbjct: 181 TDPGEYCVVAPDTEIFCEGEPIKREDEERLNDVGYDDVGGVRKQMAQIRELVELPLRHPQ 240

Query: 240 LFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRK 299
           LFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRK
Sbjct: 241 LFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRK 300

Query: 300 AFEEAEKNAPSIIFIDELDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATN 359
           AFEEAEKN+PSIIFIDELDSIAPKREKTHGEVERRIVSQLLTLMDGLK+R+HVIV+GATN
Sbjct: 301 AFEEAEKNSPSIIFIDELDSIAPKREKTHGEVERRIVSQLLTLMDGLKTRSHVIVIGATN 360

Query: 360 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVG 419
           RPNSIDPALRRFGRFDREIDIGVPDEVGRLE+LRIHTKNMKL+++VDLE+VA+DTHGYVG
Sbjct: 361 RPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDNVDLEKVARDTHGYVG 420

Query: 420 SDLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETV 479
           +DLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTAL +SNPSALRETV
Sbjct: 421 ADLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALSSSNPSALRETV 480

Query: 480 VEVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLA 539
           VEVPNVSW+DIGGL+NVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLA
Sbjct: 481 VEVPNVSWDDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLA 540

Query: 540 KAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGS 599
           KAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGS
Sbjct: 541 KAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGS 600

Query: 600 STGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLP 659
           S GDAGGAADRVLNQLLTEMDGM AKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLP
Sbjct: 601 SVGDAGGAADRVLNQLLTEMDGMTAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLP 660

Query: 660 DEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIE 719
           DE+SRLQIFKACLRKSPIS DVDLSALAR+THGFSGADITE+CQRACKYAIRE+IEK IE
Sbjct: 661 DESSRLQIFKACLRKSPISKDVDLSALARFTHGFSGADITEICQRACKYAIREDIEKGIE 720

Query: 720 RERRKRENPEAMEEDEVDDVAEIKAVHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGF 779
           +ERRKRENPEAMEED+ D+V EIK  HFEESMK+ARRSVSDADIRKYQLFAQTLQQSRGF
Sbjct: 721 KERRKRENPEAMEEDDTDEVPEIKPAHFEESMKFARRSVSDADIRKYQLFAQTLQQSRGF 780

Query: 780 GSEFRFADRTESAAAGAADPFSSATAAAADDDDLYN 815
           GSEFRF D+ E+ AAGA+DPFSS TA    DDDLY+
Sbjct: 781 GSEFRFPDQNENTAAGASDPFSSVTAEG--DDDLYS 814




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356518956|ref|XP_003528141.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449440656|ref|XP_004138100.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|224121826|ref|XP_002318682.1| predicted protein [Populus trichocarpa] gi|222859355|gb|EEE96902.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224133614|ref|XP_002321618.1| predicted protein [Populus trichocarpa] gi|222868614|gb|EEF05745.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225456951|ref|XP_002281671.1| PREDICTED: cell division cycle protein 48 homolog [Vitis vinifera] gi|297733738|emb|CBI14985.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356505246|ref|XP_003521403.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] Back     alignment and taxonomy information
>gi|147782460|emb|CAN61919.1| hypothetical protein VITISV_038729 [Vitis vinifera] Back     alignment and taxonomy information
>gi|351727028|ref|NP_001235099.1| cell division cycle protein 48 homolog [Glycine max] gi|1705678|sp|P54774.1|CDC48_SOYBN RecName: Full=Cell division cycle protein 48 homolog; AltName: Full=Valosin-containing protein homolog; Short=VCP gi|862480|gb|AAA80587.1| valosin-containing protein [Glycine max] gi|86212372|gb|ABC87759.1| plamsma membrane-associated AAA-ATPase [Glycine max] Back     alignment and taxonomy information
>gi|255556938|ref|XP_002519502.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi|223541365|gb|EEF42916.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query815
TAIR|locus:2831844810 AtCDC48C "cell division cycle 0.938 0.944 0.868 0.0
TAIR|locus:2101933815 AtCDC48B "AT3G53230" [Arabidop 0.936 0.936 0.862 0.0
TAIR|locus:2085064809 CDC48 "cell division cycle 48" 0.934 0.941 0.868 0.0
DICTYBASE|DDB_G0288065793 cdcD "CDC48 family AAA ATPase" 0.933 0.959 0.780 0.0
ZFIN|ZDB-GENE-030131-5408806 vcp "valosin containing protei 0.932 0.942 0.772 0.0
UNIPROTKB|P55072806 VCP "Transitional endoplasmic 0.932 0.942 0.766 0.0
MGI|MGI:99919806 Vcp "valosin containing protei 0.932 0.942 0.766 0.0
RGD|621595806 Vcp "valosin-containing protei 0.932 0.942 0.766 0.0
UNIPROTKB|G3X757806 VCP "Transitional endoplasmic 0.932 0.942 0.765 0.0
UNIPROTKB|Q3ZBT1806 VCP "Transitional endoplasmic 0.932 0.942 0.765 0.0
TAIR|locus:2831844 AtCDC48C "cell division cycle 48C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 3459 (1222.7 bits), Expect = 0., P = 0.
 Identities = 666/767 (86%), Positives = 703/767 (91%)

Query:    24 YSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVV 83
             +STAIL+RKKSPNRLVVDEAINDDNSV+++HP TMEKLQ FRGDT+L+KGKKRKDTVC+ 
Sbjct:    16 FSTAILERKKSPNRLVVDEAINDDNSVVSLHPTTMEKLQLFRGDTILIKGKKRKDTVCIA 75

Query:    84 LSDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLF 143
             L+DE CE  K+R+NKVVRSNLRVRLGDV+SVH CPDVKYG+RVHILP+DDT+EGVTGNLF
Sbjct:    76 LADETCEEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGKRVHILPVDDTVEGVTGNLF 135

Query:   144 DAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKR 203
             DAYLKPYF+E+YRPVRKGDLFLVRGGMRSVEFKVIETDP EYCVVAPDTEIFCEGEPVKR
Sbjct:   136 DAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCVVAPDTEIFCEGEPVKR 195

Query:   204 EDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKT 263
             EDEERL+EVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKT
Sbjct:   196 EDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKT 255

Query:   264 LIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPK 323
             LIARAVANETGAFFF INGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDE+DSIAPK
Sbjct:   256 LIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPK 315

Query:   324 REKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVP 383
             REKT+GEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVP
Sbjct:   316 REKTNGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVP 375

Query:   384 DEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDL 443
             DE+GRLE+LRIHTKNMKLAEDVDLER++KDTHGYVG+DLAALCTEAALQCIREKMDVIDL
Sbjct:   376 DEIGRLEVLRIHTKNMKLAEDVDLERISKDTHGYVGADLAALCTEAALQCIREKMDVIDL 435

Query:   444 EDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQET 503
             ED++IDAE+LNSMAV+NEHF TALG SNPSALRETVVEVPNVSWEDIGGL+NVKRELQET
Sbjct:   436 EDDSIDAEILNSMAVSNEHFHTALGNSNPSALRETVVEVPNVSWEDIGGLENVKRELQET 495

Query:   504 VQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWF 563
             VQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWF
Sbjct:   496 VQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWF 555

Query:   564 GESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSTXXXXXXXXRVLNQLLTEMDGMN 623
             GESEANVREIFDKARQSAPCVLFFDELDSIATQRG+S         RVLNQLLTEMDGMN
Sbjct:   556 GESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTEMDGMN 615

Query:   624 AKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDL 683
             AKKTVFIIGATNRPDIID ALLRPGRLDQLIYIPLPDE SRL IFKACLRKSP++ DVD+
Sbjct:   616 AKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDV 675

Query:   684 SALARYTHGFSGADITEVCQRACKYAXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXX 743
             +ALA+YT GFSGADITE+CQRACKYA                  P               
Sbjct:   676 TALAKYTQGFSGADITEICQRACKYAIRENIEKDIENERRRSQNPEAMEEDMVDDEVSEI 735

Query:   744 -XXHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRFADRT 789
                HFEESMKYARRSVSDADIRKYQ FAQTLQQSRGFGSEFRF D T
Sbjct:   736 RAAHFEESMKYARRSVSDADIRKYQAFAQTLQQSRGFGSEFRF-DST 781




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016887 "ATPase activity" evidence=ISS
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005618 "cell wall" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005829 "cytosol" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
TAIR|locus:2101933 AtCDC48B "AT3G53230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085064 CDC48 "cell division cycle 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288065 cdcD "CDC48 family AAA ATPase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99919 Vcp "valosin containing protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621595 Vcp "valosin-containing protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBT1 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q07590SAV_SULACNo assigned EC number0.46180.86620.9051yesno
Q58556Y1156_METJANo assigned EC number0.52660.83430.7530yesno
P54609CD48A_ARATHNo assigned EC number0.89710.98650.9938yesno
Q9SCN8CD48D_ARATHNo assigned EC number0.87450.98400.9840nono
P46462TERA_RATNo assigned EC number0.79220.94600.9565yesno
Q3ZBT1TERA_BOVINNo assigned EC number0.79090.94600.9565yesno
O28972Y1297_ARCFUNo assigned EC number0.49590.89070.9904yesno
Q9P3A7CDC48_SCHPONo assigned EC number0.70500.93860.9386yesno
P55072TERA_HUMANNo assigned EC number0.79220.94600.9565yesno
Q01853TERA_MOUSENo assigned EC number0.79220.94600.9565yesno
Q5AWS6CDC48_EMENINo assigned EC number0.68970.97660.9671yesno
Q8SSJ5CDC48_ENCCUNo assigned EC number0.58450.92020.9615yesno
Q7KN62TERA_DROMENo assigned EC number0.73090.97660.9937yesno
Q9LZF6CD48E_ARATHNo assigned EC number0.89670.96800.9740yesno
P54811TERA1_CAEELNo assigned EC number0.70900.98030.9876nono
P54812TERA2_CAEELNo assigned EC number0.73310.95700.9629yesno
Q7ZU99TERA_DANRENo assigned EC number0.79810.94600.9565yesno
Q6GL04TERA_XENTRNo assigned EC number0.79220.94600.9577yesno
O05209VAT_THEACNo assigned EC number0.48990.80120.8765yesno
P54774CDC48_SOYBNNo assigned EC number0.91030.98150.9913nono
P25694CDC48_YEASTNo assigned EC number0.67310.98150.9580yesno
P23787TERA_XENLANo assigned EC number0.79090.94600.9577N/Ano
Q96372CDC48_CAPANNo assigned EC number0.89420.98280.9950N/Ano
P03974TERA_PIGNo assigned EC number0.78960.94600.9565yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 0.0
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 0.0
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 1e-94
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 8e-94
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 4e-93
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 6e-92
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-86
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 2e-83
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 5e-83
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-73
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-73
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 4e-73
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 9e-71
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 2e-69
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 5e-65
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 5e-64
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 3e-63
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-61
CHL00176638 CHL00176, ftsH, cell division protein; Validated 8e-61
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 6e-60
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-56
pfam00004131 pfam00004, AAA, ATPase family associated with vari 7e-56
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-55
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-53
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 5e-52
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-51
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 1e-50
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 8e-32
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 5e-31
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 5e-31
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-21
pfam0235984 pfam02359, CDC48_N, Cell division protein 48 (CDC4 4e-21
smart00382148 smart00382, AAA, ATPases associated with a variety 9e-21
smart0107382 smart01073, CDC48_N, Cell division protein 48 (CDC 1e-18
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 2e-15
smart0107264 smart01072, CDC48_2, Cell division protein 48 (CDC 4e-12
PRK13342413 PRK13342, PRK13342, recombination factor protein R 6e-11
pfam0293361 pfam02933, CDC48_2, Cell division protein 48 (CDC4 7e-09
PRK13342413 PRK13342, PRK13342, recombination factor protein R 1e-08
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 1e-08
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 5e-08
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 7e-08
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 3e-07
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 6e-07
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisi 8e-07
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 1e-06
COG0542786 COG0542, clpA, ATP-binding subunits of Clp proteas 2e-06
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 2e-06
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 3e-06
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 5e-06
COG0593408 COG0593, DnaA, ATPase involved in DNA replication 5e-06
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 5e-06
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 6e-06
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 1e-05
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 3e-05
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 4e-05
PRK04195482 PRK04195, PRK04195, replication factor C large sub 5e-05
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 6e-05
pfam13401124 pfam13401, AAA_22, AAA domain 8e-05
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 9e-05
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 1e-04
COG1224450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 1e-04
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 1e-04
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 1e-04
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 1e-04
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 2e-04
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 3e-04
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 4e-04
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 5e-04
COG0542 786 COG0542, clpA, ATP-binding subunits of Clp proteas 8e-04
PRK06835329 PRK06835, PRK06835, DNA replication protein DnaC; 9e-04
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 0.001
pfam00910105 pfam00910, RNA_helicase, RNA helicase 0.001
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 0.002
TIGR02881261 TIGR02881, spore_V_K, stage V sporulation protein 0.002
pfam13207114 pfam13207, AAA_17, AAA domain 0.002
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 0.002
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 0.004
pfam01057271 pfam01057, Parvo_NS1, Parvovirus non-structural pr 0.004
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
 Score =  752 bits (1943), Expect = 0.0
 Identities = 368/745 (49%), Positives = 509/745 (68%), Gaps = 22/745 (2%)

Query: 37  RLVVDEAINDD--NSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASK- 93
            L V EA   D    ++ +   T  +L    GD V ++   R   V +V      +  + 
Sbjct: 3   ELRVAEAYPRDVGRGIVRIDRQTAARLGVEPGDFVEIEKGDRS-VVAIVWPLRPDDEGRG 61

Query: 94  -VRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFM 152
            +R++  +R+N  V +GD V+V    +VK  ++V + P   T     G  F  Y+K + +
Sbjct: 62  IIRMDGYLRANAGVTIGDTVTVERA-EVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLL 117

Query: 153 ESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKREDEERLNEV 212
              +P+ KG+  +V     ++ F V+ T P  +  V   TE+    +PV+ E E ++ +V
Sbjct: 118 G--KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEATEVEIREKPVREEIERKVPKV 175

Query: 213 GYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANE 272
            Y+D+GG+++   +IRE+VELP++HP+LF+ +G++PPKG+LLYGPPG+GKTL+A+AVANE
Sbjct: 176 TYEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVANE 235

Query: 273 TGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPKREKTHGEVE 332
            GA+F  INGPEIMSK  GESE  LR+ F+EAE+NAPSIIFIDE+D+IAPKRE+  GEVE
Sbjct: 236 AGAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVE 295

Query: 333 RRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEIL 392
           +R+V+QLLTLMDGLK R  VIV+GATNRP+++DPALRR GRFDREI I VPD+  R EIL
Sbjct: 296 KRVVAQLLTLMDGLKGRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEIL 355

Query: 393 RIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDV--IDLEDETIDA 450
           ++HT+NM LAEDVDL+++A+ THG+VG+DLAAL  EAA+  +R  +    I+ E E I A
Sbjct: 356 KVHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAMAALRRFIREGKINFEAEEIPA 415

Query: 451 EVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQETVQYPVEH 510
           EVL  + VT + F  AL    PSA+RE +VEVPNV W DIGGL+ VK+EL+E V++P++H
Sbjct: 416 EVLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKH 475

Query: 511 PEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANV 570
           PE FEK G+ P KGVL +GPPG GKTLLAKA+A E  ANFI+V+GPE+L+ W GESE  +
Sbjct: 476 PEIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAI 535

Query: 571 REIFDKARQSAPCVLFFDELDSIATQRGSSTGDAGGAADRVLNQLLTEMDGMNAKKTVFI 630
           REIF KARQ+AP ++FFDE+D+IA  RG+    +    DR++NQLLTEMDG+     V +
Sbjct: 536 REIFRKARQAAPAIIFFDEIDAIAPARGARFDTS--VTDRIVNQLLTEMDGIQELSNVVV 593

Query: 631 IGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYT 690
           I ATNRPDI+DPALLRPGR D+LI +P PDE +R +IFK   R  P++ DVDL  LA  T
Sbjct: 594 IAATNRPDILDPALLRPGRFDRLILVPPPDEEARKEIFKIHTRSMPLAEDVDLEELAEMT 653

Query: 691 HGFSGADITEVCQRACKYAIRENIEKDIERERRKRENPEAMEEDEVDDVAEIKAVHFEES 750
            G++GADI  VC+ A   A+RE+I          +E  E  EE+ + D+ +++  HF E+
Sbjct: 654 EGYTGADIEAVCREAAMAALRESIGSP------AKEKLEVGEEEFLKDL-KVEMRHFLEA 706

Query: 751 MKYARRSVSDADIRKYQLFAQTLQQ 775
           +K  + SVS  D+ +Y+  A+ L++
Sbjct: 707 LKKVKPSVSKEDMLRYERLAKELKR 731


This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733

>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|216993 pfam02359, CDC48_N, Cell division protein 48 (CDC48), N-terminal domain Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|215012 smart01073, CDC48_N, Cell division protein 48 (CDC48) N-terminal domain Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|215011 smart01072, CDC48_2, Cell division protein 48 (CDC48) domain 2 Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|202475 pfam02933, CDC48_2, Cell division protein 48 (CDC48), domain 2 Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235871 PRK06835, PRK06835, DNA replication protein DnaC; Validated Back     alignment and domain information
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|216270 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1 Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 815
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
KOG0734752 consensus AAA+-type ATPase containing the peptidas 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
CHL00176 638 ftsH cell division protein; Validated 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 100.0
CHL00206 2281 ycf2 Ycf2; Provisional 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0731774 consensus AAA+-type ATPase containing the peptidas 100.0
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.98
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.97
CHL00195489 ycf46 Ycf46; Provisional 99.97
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.97
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.97
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.97
CHL00176638 ftsH cell division protein; Validated 99.96
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.96
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.96
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.95
CHL00095821 clpC Clp protease ATP binding subunit 99.95
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.95
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.95
CHL002062281 ycf2 Ycf2; Provisional 99.95
PRK10865857 protein disaggregation chaperone; Provisional 99.95
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.94
CHL00181287 cbbX CbbX; Provisional 99.88
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.87
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.87
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.86
PF00004132 AAA: ATPase family associated with various cellula 99.86
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.86
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.85
PF00004132 AAA: ATPase family associated with various cellula 99.79
CHL00181287 cbbX CbbX; Provisional 99.75
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.75
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.73
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.73
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.72
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.71
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.71
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.68
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.68
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.68
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.67
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.66
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.66
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.65
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.64
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.6
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.6
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.58
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.57
PRK13342 413 recombination factor protein RarA; Reviewed 99.55
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.55
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.55
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.54
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.54
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.54
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK10865 857 protein disaggregation chaperone; Provisional 99.54
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.54
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.52
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.52
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.52
PRK00149450 dnaA chromosomal replication initiation protein; R 99.52
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.52
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.51
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.51
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.51
PRK07940394 DNA polymerase III subunit delta'; Validated 99.5
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.5
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.49
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.49
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.49
CHL00095 821 clpC Clp protease ATP binding subunit 99.48
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.47
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.47
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.47
PRK12422445 chromosomal replication initiation protein; Provis 99.47
PRK04195 482 replication factor C large subunit; Provisional 99.46
PRK13341 725 recombination factor protein RarA/unknown domain f 99.46
PRK14088440 dnaA chromosomal replication initiation protein; P 99.45
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.44
PRK14086617 dnaA chromosomal replication initiation protein; P 99.44
KOG2028 554 consensus ATPase related to the helicase subunit o 99.43
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.43
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.41
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.4
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.4
PRK06893229 DNA replication initiation factor; Validated 99.39
PRK12402337 replication factor C small subunit 2; Reviewed 99.39
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.38
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.37
PTZ001121164 origin recognition complex 1 protein; Provisional 99.37
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.36
PLN03025319 replication factor C subunit; Provisional 99.35
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.35
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.35
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.35
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 99.35
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.35
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.35
PRK04195482 replication factor C large subunit; Provisional 99.34
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.34
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.34
PRK14087450 dnaA chromosomal replication initiation protein; P 99.34
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.34
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.33
PF0235987 CDC48_N: Cell division protein 48 (CDC48), N-termi 99.33
PHA02544316 44 clamp loader, small subunit; Provisional 99.33
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.33
PRK13342413 recombination factor protein RarA; Reviewed 99.31
PRK07940394 DNA polymerase III subunit delta'; Validated 99.31
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.29
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.29
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.29
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.29
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.28
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.28
PRK08084235 DNA replication initiation factor; Provisional 99.28
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.28
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 99.28
PLN03025319 replication factor C subunit; Provisional 99.27
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.27
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.27
PRK05642234 DNA replication initiation factor; Validated 99.26
COG0593408 DnaA ATPase involved in DNA replication initiation 99.26
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.26
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 99.26
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.25
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.25
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.25
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.24
COG0488530 Uup ATPase components of ABC transporters with dup 99.24
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.24
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.23
PHA02544316 44 clamp loader, small subunit; Provisional 99.23
PRK08727233 hypothetical protein; Validated 99.23
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.23
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.23
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.22
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.22
PRK00149450 dnaA chromosomal replication initiation protein; R 99.22
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.22
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.22
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.21
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.21
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.21
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.21
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.21
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.21
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 99.21
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.2
PRK12402337 replication factor C small subunit 2; Reviewed 99.2
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.2
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.19
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.19
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.19
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.18
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.18
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.18
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.18
PRK06620214 hypothetical protein; Validated 99.18
PRK00440319 rfc replication factor C small subunit; Reviewed 99.18
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 99.17
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.17
PRK06893229 DNA replication initiation factor; Validated 99.17
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.16
PRK14088440 dnaA chromosomal replication initiation protein; P 99.16
PRK14086617 dnaA chromosomal replication initiation protein; P 99.16
PRK08084235 DNA replication initiation factor; Provisional 99.15
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.15
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.14
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.14
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.13
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.13
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.13
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.13
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.13
KOG2028554 consensus ATPase related to the helicase subunit o 99.13
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 99.13
PRK13341 725 recombination factor protein RarA/unknown domain f 99.12
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.12
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.12
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.12
PTZ001121164 origin recognition complex 1 protein; Provisional 99.12
PRK12422445 chromosomal replication initiation protein; Provis 99.1
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.1
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.1
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.1
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.09
PHA02244383 ATPase-like protein 99.09
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.08
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.08
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.08
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.08
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.07
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.07
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.07
PRK09087226 hypothetical protein; Validated 99.06
smart00382148 AAA ATPases associated with a variety of cellular 99.06
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.06
COG0714329 MoxR-like ATPases [General function prediction onl 99.05
PRK00440319 rfc replication factor C small subunit; Reviewed 99.05
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.04
PRK05642234 DNA replication initiation factor; Validated 99.04
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.04
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.03
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.03
KOG0745564 consensus Putative ATP-dependent Clp-type protease 99.03
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.03
PRK08727233 hypothetical protein; Validated 99.03
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.03
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.02
COG1123539 ATPase components of various ABC-type transport sy 99.02
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.01
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.01
PRK09112351 DNA polymerase III subunit delta'; Validated 99.0
PRK14087450 dnaA chromosomal replication initiation protein; P 99.0
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 98.99
PRK05564313 DNA polymerase III subunit delta'; Validated 98.99
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 98.98
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.97
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 98.97
PRK07471365 DNA polymerase III subunit delta'; Validated 98.97
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.97
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.96
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 98.96
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.95
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.95
smart00382148 AAA ATPases associated with a variety of cellular 98.92
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.91
PRK06620214 hypothetical protein; Validated 98.91
PHA02244383 ATPase-like protein 98.91
KOG0927614 consensus Predicted transporter (ABC superfamily) 98.91
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.9
COG0593408 DnaA ATPase involved in DNA replication initiation 98.89
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.89
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.89
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.88
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.88
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.87
PRK07399314 DNA polymerase III subunit delta'; Validated 98.87
PRK05707328 DNA polymerase III subunit delta'; Validated 98.85
COG0714329 MoxR-like ATPases [General function prediction onl 98.84
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 98.84
PRK10636638 putative ABC transporter ATP-binding protein; Prov 98.84
PRK04132846 replication factor C small subunit; Provisional 98.84
KOG1969877 consensus DNA replication checkpoint protein CHL12 98.82
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.8
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.8
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.8
PRK09087226 hypothetical protein; Validated 98.79
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.79
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.78
PRK09112351 DNA polymerase III subunit delta'; Validated 98.78
PRK13531 498 regulatory ATPase RavA; Provisional 98.77
PRK08058329 DNA polymerase III subunit delta'; Validated 98.76
smart00350509 MCM minichromosome maintenance proteins. 98.75
COG4172534 ABC-type uncharacterized transport system, duplica 98.75
PRK11147635 ABC transporter ATPase component; Reviewed 98.73
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.73
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 98.73
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.72
PF07726131 AAA_3: ATPase family associated with various cellu 98.72
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.72
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.72
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.71
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.7
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.7
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.7
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.69
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.68
PRK06964342 DNA polymerase III subunit delta'; Validated 98.68
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.67
PRK09700510 D-allose transporter ATP-binding protein; Provisio 98.66
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 98.66
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.66
PRK10938490 putative molybdenum transport ATP-binding protein 98.66
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.66
PF07726131 AAA_3: ATPase family associated with various cellu 98.66
PRK15064530 ABC transporter ATP-binding protein; Provisional 98.65
PRK05564313 DNA polymerase III subunit delta'; Validated 98.65
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 98.65
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 98.64
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.64
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.64
PRK07471365 DNA polymerase III subunit delta'; Validated 98.64
PRK10762501 D-ribose transporter ATP binding protein; Provisio 98.63
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.63
COG1221403 PspF Transcriptional regulators containing an AAA- 98.63
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.62
PLN03073718 ABC transporter F family; Provisional 98.62
PRK08116268 hypothetical protein; Validated 98.62
PRK13531498 regulatory ATPase RavA; Provisional 98.61
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.6
PRK11608326 pspF phage shock protein operon transcriptional ac 98.59
PRK09862506 putative ATP-dependent protease; Provisional 98.59
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.56
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 98.56
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.55
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.55
PRK06871325 DNA polymerase III subunit delta'; Validated 98.54
PRK11819556 putative ABC transporter ATP-binding protein; Revi 98.54
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 98.54
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.53
PRK15424538 propionate catabolism operon regulatory protein Pr 98.53
PRK11288501 araG L-arabinose transporter ATP-binding protein; 98.53
PRK13409590 putative ATPase RIL; Provisional 98.53
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 98.52
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.51
PRK10261623 glutathione transporter ATP-binding protein; Provi 98.51
PRK07993334 DNA polymerase III subunit delta'; Validated 98.51
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.49
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.49
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.49
PRK05707328 DNA polymerase III subunit delta'; Validated 98.49
PRK04132846 replication factor C small subunit; Provisional 98.48
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.47
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.47
PRK07399314 DNA polymerase III subunit delta'; Validated 98.47
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.46
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.45
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.44
PRK08769319 DNA polymerase III subunit delta'; Validated 98.44
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.43
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.43
PRK08116268 hypothetical protein; Validated 98.43
PRK09302509 circadian clock protein KaiC; Reviewed 98.42
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.42
PRK08058329 DNA polymerase III subunit delta'; Validated 98.42
KOG0062582 consensus ATPase component of ABC transporters wit 98.42
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.41
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.4
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.39
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.38
PRK09183259 transposase/IS protein; Provisional 98.38
PRK08181269 transposase; Validated 98.38
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.37
PRK08699325 DNA polymerase III subunit delta'; Validated 98.37
PRK06090319 DNA polymerase III subunit delta'; Validated 98.36
PRK13765 637 ATP-dependent protease Lon; Provisional 98.36
COG2204464 AtoC Response regulator containing CheY-like recei 98.36
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.34
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.34
PRK09183259 transposase/IS protein; Provisional 98.33
PRK07952244 DNA replication protein DnaC; Validated 98.33
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.33
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.33
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.32
PF13173128 AAA_14: AAA domain 98.31
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.31
PRK08181269 transposase; Validated 98.3
PF13173128 AAA_14: AAA domain 98.3
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.29
PRK06526254 transposase; Provisional 98.29
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.29
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.27
PRK08939306 primosomal protein DnaI; Reviewed 98.27
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.27
PRK12377248 putative replication protein; Provisional 98.27
COG4619223 ABC-type uncharacterized transport system, ATPase 98.26
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.25
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.25
PRK12377248 putative replication protein; Provisional 98.25
PRK06526254 transposase; Provisional 98.25
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.25
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 98.25
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.24
COG3842352 PotA ABC-type spermidine/putrescine transport syst 98.24
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.23
smart00350509 MCM minichromosome maintenance proteins. 98.23
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.22
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.21
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.21
PRK06964342 DNA polymerase III subunit delta'; Validated 98.21
PRK06871325 DNA polymerase III subunit delta'; Validated 98.21
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.2
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 98.2
PRK15424538 propionate catabolism operon regulatory protein Pr 98.2
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.19
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.19
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.19
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.19
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.18
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.18
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.18
PRK11608326 pspF phage shock protein operon transcriptional ac 98.18
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.18
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.17
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.17
COG1221403 PspF Transcriptional regulators containing an AAA- 98.17
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.16
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.16
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.16
PRK06921266 hypothetical protein; Provisional 98.16
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.14
PRK06835329 DNA replication protein DnaC; Validated 98.13
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.13
PRK07993334 DNA polymerase III subunit delta'; Validated 98.13
PRK07952244 DNA replication protein DnaC; Validated 98.13
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.12
PRK09862506 putative ATP-dependent protease; Provisional 98.12
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.1
PRK06921266 hypothetical protein; Provisional 98.1
PRK06835329 DNA replication protein DnaC; Validated 98.1
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.09
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.08
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.08
PRK08699325 DNA polymerase III subunit delta'; Validated 98.08
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.07
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 98.07
PRK08769319 DNA polymerase III subunit delta'; Validated 98.07
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 98.06
cd03246173 ABCC_Protease_Secretion This family represents the 98.06
PF05729166 NACHT: NACHT domain 98.06
COG2204464 AtoC Response regulator containing CheY-like recei 98.04
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.04
PRK06090319 DNA polymerase III subunit delta'; Validated 98.03
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.03
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.03
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 98.02
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.02
PRK06851367 hypothetical protein; Provisional 98.02
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.01
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.01
TIGR02237209 recomb_radB DNA repair and recombination protein R 98.01
PRK08939306 primosomal protein DnaI; Reviewed 98.01
PRK15115444 response regulator GlrR; Provisional 98.0
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.99
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.99
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 97.98
COG4618580 ArpD ABC-type protease/lipase transport system, AT 97.97
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 97.95
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.94
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.93
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 97.93
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.93
PRK05917290 DNA polymerase III subunit delta'; Validated 97.92
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 97.91
COG4167267 SapF ABC-type antimicrobial peptide transport syst 97.91
COG1127263 Ttg2A ABC-type transport system involved in resist 97.9
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.9
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=7.3e-120  Score=991.34  Aligned_cols=690  Identities=61%  Similarity=1.003  Sum_probs=642.9

Q ss_pred             CccchhhhhcCCCCceEEEccccCCCccEEEeCHHHHHhcCCCCCCEEEEecCCCceEEEEEEecCCCCCCeEEecHHhh
Q 003499           22 KDYSTAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVLSDELCEASKVRVNKVVR  101 (815)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~v~~~~~~~~~~v~~~~~~~~~l~~~~g~~v~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~r  101 (815)
                      .+++++|+..+..++.++|.+ .++.++.+.+++..|..+++..|  |.+.|+.+...++.+...+. ....+.++...|
T Consensus         2 ~~~~~~~~~~~~~~~~~~v~~-~~~~~~~~~~~~~~~~~~~l~~g--~~~~g~~~~~~~~~~~~~~~-~~~~~~~~~~~r   77 (693)
T KOG0730|consen    2 ESPSTAILPVKCPQNNLVVLS-INDDASVVVLSEGAMDKLGLLRG--VLLDGKKRREPVDAVVQDET-SELIGRQTMVSR   77 (693)
T ss_pred             CcccccccccccCCCCeEEec-CCCccchheecHHHHhhhcCCcc--eEEECccccCCccceeccCC-ccccchhhheec
Confidence            478899999999999999988 45555689999999999999999  99999887666555443444 678889999999


Q ss_pred             hhcccccCCeeEEEecCCCCCCcEEEecccCCcccCcchhhHHHHhhHhhhhcCcccccCcEEEEecCceeEEEEEEEec
Q 003499          102 SNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFDAYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETD  181 (815)
Q Consensus       102 ~~~~~~~g~~v~v~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~v~~g~~~~~~~~~~~~~f~v~~~~  181 (815)
                      .++.++.|+.|.+++++.+..+.++.+.|+..+..++..+.++.+.+.|+....+++..|+++   ..+..+.|++++..
T Consensus        78 ~~l~~~~~~~~~~~~~p~v~~~~~i~~l~~~~~~~~i~~~~~d~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~  154 (693)
T KOG0730|consen   78 SNLRLQLGRLLHSSDCPSVKRPARIAVLPVDDTSEGIAGELFDVLERPFLLEALRPLVKGDTF---AGLNPAEFKVLELD  154 (693)
T ss_pred             cchhhcccceecccCCCCccccceeeeeehhhccccchhhhhhhhhhhhhhhhhCccccccch---hhhhhhhhhccccc
Confidence            999999999999999888888888999999998888888888889999999888999899887   44456778888887


Q ss_pred             CCceeeeCCCceEEecCCCCccccccccCCCCcccccChHHHHHHHHHHHHcccCChhhHhhhCCCCCceEEEECCCCCc
Q 003499          182 PGEYCVVAPDTEIFCEGEPVKREDEERLNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSG  261 (815)
Q Consensus       182 p~~~~~~~~~t~i~~~~~~~~~~~~~~~~~~~~~~i~G~~~~~~~i~~~v~~~l~~~~~~~~l~i~~~~~VLL~GppGtG  261 (815)
                      |..  ++.++|.+.+.+++......+ +.+++ +++||+..++..+++++++|+.+|..+.++|+.+|+++|+|||||||
T Consensus       155 ~~~--~v~~~t~~~~~~~~~~~~~~~-~~~~~-~~~gg~~~~~~~i~e~v~~pl~~~~~~~s~g~~~prg~Ll~gppg~G  230 (693)
T KOG0730|consen  155 PSP--QVTPDTELSYLGEPAKREEEE-LPEVG-DDIGGLKRQLSVIRELVELPLRHPALFKSIGIKPPRGLLLYGPPGTG  230 (693)
T ss_pred             cch--hcCccchhhhcCCCccccccc-ccccc-cccchhHHHHHHHHHHHHhhhcchhhhhhcCCCCCCCccccCCCCCC
Confidence            776  778899988887777654444 47778 89999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCeEEEEechhhhhhhhchhHHHHHHHHHHHHhcC-CcEEEecccccccCCCCCchhHHHHHHHHHHH
Q 003499          262 KTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNA-PSIIFIDELDSIAPKREKTHGEVERRIVSQLL  340 (815)
Q Consensus       262 KTtLar~la~~l~~~~i~v~~~~l~~~~~g~~~~~l~~vf~~a~~~~-p~il~iDEid~l~~~~~~~~~~~~~~v~~~Ll  340 (815)
                      ||.+++++|++.++.++.++++++++++.|++++.+|..|+.+...+ |+++||||+|.+++++....+ +++|++.+|+
T Consensus       231 kt~l~~aVa~e~~a~~~~i~~peli~k~~gEte~~LR~~f~~a~k~~~psii~IdEld~l~p~r~~~~~-~e~Rv~sqll  309 (693)
T KOG0730|consen  231 KTFLVRAVANEYGAFLFLINGPELISKFPGETESNLRKAFAEALKFQVPSIIFIDELDALCPKREGADD-VESRVVSQLL  309 (693)
T ss_pred             hHHHHHHHHHHhCceeEecccHHHHHhcccchHHHHHHHHHHHhccCCCeeEeHHhHhhhCCcccccch-HHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999998 999999999999999877666 8899999999


Q ss_pred             HhhhcccCCCcEEEEEecCCCCCCCHHhhccCCcceEEEcCCCCHHHHHHHHHHHhcCCccccchhhhHHHhhcCCCcHH
Q 003499          341 TLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGS  420 (815)
Q Consensus       341 ~~ld~~~~~~~vivi~atn~~~~ld~al~r~~rf~~~i~i~~p~~~~R~~il~~~~~~~~l~~~~~l~~la~~t~g~~~~  420 (815)
                      ++|+++.....++|+++||+|+.||+++|| |||+++++++.|+..+|.+|++.+++++++.+++++..++..+|||+|+
T Consensus       310 tL~dg~~~~~~vivl~atnrp~sld~alRR-gRfd~ev~IgiP~~~~RldIl~~l~k~~~~~~~~~l~~iA~~thGyvGa  388 (693)
T KOG0730|consen  310 TLLDGLKPDAKVIVLAATNRPDSLDPALRR-GRFDREVEIGIPGSDGRLDILRVLTKKMNLLSDVDLEDIAVSTHGYVGA  388 (693)
T ss_pred             HHHhhCcCcCcEEEEEecCCccccChhhhc-CCCcceeeecCCCchhHHHHHHHHHHhcCCcchhhHHHHHHHccchhHH
Confidence            999999999999999999999999999999 9999999999999999999999999999998889999999999999999


Q ss_pred             HHHHHHHHHHHHhHHhhcccccccccchhhhhhcccccccccccccccccCCCcccccccccCCcccccccccchhhhhh
Q 003499          421 DLAALCTEAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKREL  500 (815)
Q Consensus       421 dl~~l~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~al~~~~p~~~~~~~~~~~~~~~~~i~g~~~~k~~l  500 (815)
                      |+.++|++|++.+.++                      ++++|..|+..+.|+++|+..++.|+++|+||||++++|+.|
T Consensus       389 DL~~l~~ea~~~~~r~----------------------~~~~~~~A~~~i~psa~Re~~ve~p~v~W~dIGGlE~lK~el  446 (693)
T KOG0730|consen  389 DLAALCREASLQATRR----------------------TLEIFQEALMGIRPSALREILVEMPNVSWDDIGGLEELKREL  446 (693)
T ss_pred             HHHHHHHHHHHHHhhh----------------------hHHHHHHHHhcCCchhhhheeccCCCCChhhccCHHHHHHHH
Confidence            9999999999988765                      456788899999999999999999999999999999999999


Q ss_pred             hccccCCCCChhhhhhhcCCCCcceEEeCCCCCChhHHHHHHHHHhCCcEEEEeccchhhhccCccHHHHHHHHHHHhhC
Q 003499          501 QETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQS  580 (815)
Q Consensus       501 ~~~i~~~~~~~~~~~~~~~~~~~gilL~GppGtGKT~lakala~~~~~~~i~v~~~~l~~~~~g~se~~i~~~F~~a~~~  580 (815)
                      ++.|.||+++++.|.++|+++++|||||||||||||++||++|++++.+|++|++++++++|+|++|++++++|++|++.
T Consensus       447 q~~V~~p~~~pe~F~r~Gi~ppkGVLlyGPPGC~KT~lAkalAne~~~nFlsvkgpEL~sk~vGeSEr~ir~iF~kAR~~  526 (693)
T KOG0730|consen  447 QQAVEWPLKHPEKFARFGISPPKGVLLYGPPGCGKTLLAKALANEAGMNFLSVKGPELFSKYVGESERAIREVFRKARQV  526 (693)
T ss_pred             HHHHhhhhhchHHHHHhcCCCCceEEEECCCCcchHHHHHHHhhhhcCCeeeccCHHHHHHhcCchHHHHHHHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEecchhhhhccCCCCCCCCchHHHHHHHHHhccccCCCCCcEEEEEecCCCCCCCccccCCCCCcceeeccCCC
Q 003499          581 APCVLFFDELDSIATQRGSSTGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPD  660 (815)
Q Consensus       581 ~p~ilfiDEid~l~~~r~~~~~~~~~~~~~vl~~lL~~ld~~~~~~~v~vi~aTn~~~~ld~allr~gRf~~~i~~~~p~  660 (815)
                      +|||+||||||+++..|+.+.   +++.+||+++||+||||++..++|+||||||||+.||+|++||||||++||||+||
T Consensus       527 aP~IiFfDEiDsi~~~R~g~~---~~v~~RVlsqLLtEmDG~e~~k~V~ViAATNRpd~ID~ALlRPGRlD~iiyVplPD  603 (693)
T KOG0730|consen  527 APCIIFFDEIDALAGSRGGSS---SGVTDRVLSQLLTEMDGLEALKNVLVIAATNRPDMIDPALLRPGRLDRIIYVPLPD  603 (693)
T ss_pred             CCeEEehhhHHhHhhccCCCc---cchHHHHHHHHHHHcccccccCcEEEEeccCChhhcCHHHcCCcccceeEeecCcc
Confidence            999999999999999997433   37899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhccCCCCCcccHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCcccccccccccc
Q 003499          661 EASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIERERRKRENPEAMEEDEVDDVA  740 (815)
Q Consensus       661 ~~~r~~Il~~~l~~~~~~~~~~~~~la~~t~g~sg~di~~l~~~a~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  740 (815)
                      .+.|++||+.+++++++.+++|+..||+.|+|||||||.++|++|++.|+++.++.                       .
T Consensus       604 ~~aR~~Ilk~~~kkmp~~~~vdl~~La~~T~g~SGAel~~lCq~A~~~a~~e~i~a-----------------------~  660 (693)
T KOG0730|consen  604 LEARLEILKQCAKKMPFSEDVDLEELAQATEGYSGAEIVAVCQEAALLALRESIEA-----------------------T  660 (693)
T ss_pred             HHHHHHHHHHHHhcCCCCccccHHHHHHHhccCChHHHHHHHHHHHHHHHHHhccc-----------------------c
Confidence            99999999999999999999999999999999999999999999999999998763                       3


Q ss_pred             cccHHHHHHHHhhccCCCCHHHHHHHHHHHHH
Q 003499          741 EIKAVHFEESMKYARRSVSDADIRKYQLFAQT  772 (815)
Q Consensus       741 ~i~~~~f~~a~~~~~~svs~~~~~~y~~~~~~  772 (815)
                      .|+.+||++|++..++|++.+++++|++|++.
T Consensus       661 ~i~~~hf~~al~~~r~s~~~~~~~~Ye~fa~~  692 (693)
T KOG0730|consen  661 EITWQHFEEALKAVRPSLTSELLEKYEDFAAR  692 (693)
T ss_pred             cccHHHHHHHHHhhcccCCHHHHHHHHHHhhc
Confidence            79999999999999999999999999999864



>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PF02359 CDC48_N: Cell division protein 48 (CDC48), N-terminal domain; InterPro: IPR003338 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 0.0
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 0.0
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 0.0
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 5e-51
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 0.0
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 4e-51
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 0.0
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 5e-51
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 0.0
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 7e-51
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 1e-124
3qwz_A211 Crystal Structure Of Faf1 Ubx-P97n-Domain Complex L 7e-85
2pjh_B193 Strctural Model Of The P97 N Domain- Npl4 Ubd Compl 7e-85
3qc8_A178 Crystal Structure Of Faf1 Ubx Domain In Complex Wit 2e-77
3tiw_A187 Crystal Structure Of P97n In Complex With The C-Ter 2e-76
3qq7_A186 Crystal Structure Of The P97 N-Terminal Domain Leng 3e-76
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 2e-71
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 4e-63
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 6e-64
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 2e-56
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 7e-55
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 8e-53
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 3e-54
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 5e-47
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 6e-54
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 4e-53
2ce7_A476 Edta Treated Length = 476 3e-53
2ce7_A 476 Edta Treated Length = 476 4e-50
3kds_E465 Apo-ftsh Crystal Structure Length = 465 1e-52
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 1e-49
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 4e-52
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 1e-47
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 6e-52
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 3e-49
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 4e-49
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-49
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 5e-49
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 2e-48
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 4e-48
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 4e-46
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 1e-47
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 5e-43
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-42
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 4e-42
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 4e-42
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 2e-40
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 5e-38
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 2e-39
1xwi_A322 Crystal Structure Of Vps4b Length = 322 3e-39
3b9p_A297 Spastin Length = 297 2e-36
3b9p_A297 Spastin Length = 297 1e-34
3vfd_A389 Human Spastin Aaa Domain Length = 389 3e-36
3vfd_A389 Human Spastin Aaa Domain Length = 389 2e-34
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 3e-06
1ixs_B318 Structure Of Ruvb Complexed With Ruva Domain Iii Le 3e-06
1ixs_B318 Structure Of Ruvb Complexed With Ruva Domain Iii Le 1e-04
1hqc_A324 Structure Of Ruvb From Thermus Thermophilus Hb8 Len 3e-06
1hqc_A324 Structure Of Ruvb From Thermus Thermophilus Hb8 Len 1e-04
1ixr_C312 Ruva-Ruvb Complex Length = 312 4e-06
1ixr_C312 Ruva-Ruvb Complex Length = 312 1e-04
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 5e-06
3kw6_A78 Crystal Structure Of A Domain Of 26s Proteasome Reg 3e-05
3u5z_B324 Structure Of T4 Bacteriophage Clamp Loader Bound To 1e-04
4a3v_B95 Yeast Regulatory Particle Proteasome Assembly Chape 1e-04
3pxi_A 758 Structure Of Meca108:clpc Length = 758 3e-04
3pxg_A468 Structure Of Meca121 And Clpc1-485 Complex Length = 4e-04
1j7k_A334 Thermotoga Maritima Ruvb P216g Mutant Length = 334 7e-04
1in8_A334 Thermotoga Maritima Ruvb T158v Length = 334 7e-04
1in4_A334 Thermotoga Maritima Ruvb Holliday Junction Branch M 7e-04
1in5_A334 Thermogota Maritima Ruvb A156s Mutant Length = 334 7e-04
1in7_A334 Thermotoga Maritima Ruvb R170a Length = 334 7e-04
1nsf_A273 D2 Hexamerization Domain Of N-Ethylmaleimide Sensit 8e-04
1d2n_A272 D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Prot 9e-04
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure

Iteration: 1

Score = 1228 bits (3176), Expect = 0.0, Method: Compositional matrix adjust. Identities = 585/762 (76%), Positives = 665/762 (87%), Gaps = 2/762 (0%) Query: 25 STAILDRKKSPNRLVVDEAINDDNSVITMHPNTMEKLQFFRGDTVLVKGKKRKDTVCVVL 84 STAIL +K PNRL+VDEAIN+DNSV+++ M++LQ FRGDTVL+KGKKR++ VC+VL Sbjct: 13 STAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVL 72 Query: 85 SDELCEASKVRVNKVVRSNLRVRLGDVVSVHPCPDVKYGRRVHILPIDDTIEGVTGNLFD 144 SD+ C K+R+N+VVR+NLRVRLGDV+S+ PCPDVKYG+R+H+LPIDDT+EG+TGNLF+ Sbjct: 73 SDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFE 132 Query: 145 AYLKPYFMESYRPVRKGDLFLVRGGMRSVEFKVIETDPGEYCVVAPDTEIFCEGEPVKRE 204 YLKPYF+E+YRP+RKGD+FLVRGGMR+VEFKV+ETDP YC+VAPDT I CEGEP+KRE Sbjct: 133 VYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKRE 192 Query: 205 DEER-LNEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKT 263 DEE LNEVGYDDVGG RKQ+AQI+E+VELPLRHP LFK+IGVKPP+GILLYGPPG+GKT Sbjct: 193 DEEESLNEVGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKT 252 Query: 264 LIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDELDSIAPK 323 LIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAP+IIFIDELD+IAPK Sbjct: 253 LIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPK 312 Query: 324 REKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPALRRFGRFDREIDIGVP 383 REKTHGEVERRIVSQLLTLMDGLK RAHVIVM ATNRPNSIDPALRRFGRFDRE+DIG+P Sbjct: 313 REKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIP 372 Query: 384 DEVGRLEILRIHTKNMKLAEDVDLERVAKDTHGYVGSDLAALCTEAALQCIREKMDVIDL 443 D GRLEIL+IHTKNMKLA+DVDLE+VA +THG+VG+DLAALC+EAALQ IR+KMD+IDL Sbjct: 373 DATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDL 432 Query: 444 EDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSWEDIGGLDNVKRELQET 503 EDETIDAEV+NS+AVT + F+ AL SNPSALRETVVEVP V+WEDIGGL++VKRELQE Sbjct: 433 EDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQEL 492 Query: 504 VQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWF 563 VQYPVEHP+KF KFGM+PSKGVLFYGPPGCGKTLLAKAIANECQANFIS+KGPELLTMWF Sbjct: 493 VQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWF 552 Query: 564 GESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSTXXXXXXXXRVLNQLLTEMDGMN 623 GESEANVREIFDKARQ+APCVLFFDELDSIA RG + RV+NQ+LTEMDGM+ Sbjct: 553 GESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMS 612 Query: 624 AKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDL 683 KK VFIIGATNRPDIIDPA+LRPGRLDQLIYIPLPDE SR+ I KA LRKSP++ DVDL Sbjct: 613 TKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDL 672 Query: 684 SALARYTHGFSGADITEVCQRACKYAXXXXXXXXXXXXXXXXXXPXXXXXXXXXXXXXXX 743 LA+ T+GFSGAD+TE+CQRACK A P Sbjct: 673 EFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIR 732 Query: 744 XXHFEESMKYARRSVSDADIRKYQLFAQTLQQSRGFGSEFRF 785 HFEE+M++ARRSVSD DIRKY++FAQTLQQSRGFGS FRF Sbjct: 733 RDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGS-FRF 773
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|3QWZ|A Chain A, Crystal Structure Of Faf1 Ubx-P97n-Domain Complex Length = 211 Back     alignment and structure
>pdb|2PJH|B Chain B, Strctural Model Of The P97 N Domain- Npl4 Ubd Complex Length = 193 Back     alignment and structure
>pdb|3QC8|A Chain A, Crystal Structure Of Faf1 Ubx Domain In Complex With P97VCP N DOMAIN Reveals The Conserved Fcisp Touch-Turn Motif Of Ubx Domain Suffering Conformational Change Length = 178 Back     alignment and structure
>pdb|3TIW|A Chain A, Crystal Structure Of P97n In Complex With The C-Terminus Of Gp78 Length = 187 Back     alignment and structure
>pdb|3QQ7|A Chain A, Crystal Structure Of The P97 N-Terminal Domain Length = 186 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure
>pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 Back     alignment and structure
>pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 Back     alignment and structure
>pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 Back     alignment and structure
>pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 Back     alignment and structure
>pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 Back     alignment and structure
>pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|3KW6|A Chain A, Crystal Structure Of A Domain Of 26s Proteasome Regulatory Subunit 8 From Homo Sapiens. Northeast Structural Genomics Consortium Target Id Hr3102a Length = 78 Back     alignment and structure
>pdb|3U5Z|B Chain B, Structure Of T4 Bacteriophage Clamp Loader Bound To The T4 Clamp, Primer-Template Dna, And Atp Analog Length = 324 Back     alignment and structure
>pdb|4A3V|B Chain B, Yeast Regulatory Particle Proteasome Assembly Chaperone Hsm3 In Complex With Rpt1 C-Terminal Fragment Length = 95 Back     alignment and structure
>pdb|3PXI|A Chain A, Structure Of Meca108:clpc Length = 758 Back     alignment and structure
>pdb|3PXG|A Chain A, Structure Of Meca121 And Clpc1-485 Complex Length = 468 Back     alignment and structure
>pdb|1J7K|A Chain A, Thermotoga Maritima Ruvb P216g Mutant Length = 334 Back     alignment and structure
>pdb|1IN8|A Chain A, Thermotoga Maritima Ruvb T158v Length = 334 Back     alignment and structure
>pdb|1IN4|A Chain A, Thermotoga Maritima Ruvb Holliday Junction Branch Migration Motor Length = 334 Back     alignment and structure
>pdb|1IN5|A Chain A, Thermogota Maritima Ruvb A156s Mutant Length = 334 Back     alignment and structure
>pdb|1IN7|A Chain A, Thermotoga Maritima Ruvb R170a Length = 334 Back     alignment and structure
>pdb|1NSF|A Chain A, D2 Hexamerization Domain Of N-Ethylmaleimide Sensitive Factor (Nsf) Length = 273 Back     alignment and structure
>pdb|1D2N|A Chain A, D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Protein Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query815
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 0.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 0.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-108
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 0.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-118
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-169
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-115
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-138
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 1e-94
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 1e-130
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-93
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-127
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-112
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 1e-127
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 2e-87
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 1e-118
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 2e-84
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 1e-110
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 7e-89
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-109
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 2e-93
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 1e-107
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 2e-91
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 9e-93
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 4e-64
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 3e-89
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 2e-66
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 3e-82
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 6e-77
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 2e-72
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 7e-77
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-75
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-72
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 4e-75
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 4e-72
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 6e-75
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-72
2r62_A268 Cell division protease FTSH homolog; ATPase domain 9e-75
2r62_A268 Cell division protease FTSH homolog; ATPase domain 3e-73
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-71
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 3e-69
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 2e-71
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 7e-68
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 2e-50
2krk_A86 26S protease regulatory subunit 8; structural geno 2e-24
2krk_A86 26S protease regulatory subunit 8; structural geno 7e-18
3kw6_A78 26S protease regulatory subunit 8; structural geno 6e-23
3kw6_A78 26S protease regulatory subunit 8; structural geno 7e-16
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 9e-21
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 6e-18
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 3e-20
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 6e-13
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 8e-20
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 8e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-18
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 8e-18
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 2e-12
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 2e-14
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 9e-14
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 4e-12
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 7e-08
2yuj_A190 Ubiquitin fusion degradation 1-like; ubiquitin-dep 4e-11
3pvs_A447 Replication-associated recombination protein A; ma 1e-09
3pvs_A 447 Replication-associated recombination protein A; ma 1e-08
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 1e-08
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 2e-04
2qgz_A308 Helicase loader, putative primosome component; str 9e-08
2qgz_A308 Helicase loader, putative primosome component; str 2e-05
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 1e-07
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 7e-05
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 3e-07
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 2e-05
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 1e-06
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 2e-06
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 6e-06
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 9e-04
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 6e-06
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 7e-06
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 8e-06
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 1e-05
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 9e-06
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 1e-04
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 2e-05
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 3e-05
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 3e-05
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 8e-05
2v1u_A387 Cell division control protein 6 homolog; DNA repli 1e-04
2v1u_A387 Cell division control protein 6 homolog; DNA repli 3e-04
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 2e-04
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 2e-04
2chg_A226 Replication factor C small subunit; DNA-binding pr 2e-04
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 3e-04
2chq_A319 Replication factor C small subunit; DNA-binding pr 5e-04
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 5e-04
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 5e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 7e-04
2fna_A357 Conserved hypothetical protein; structural genomic 9e-04
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Length = 211 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Length = 187 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Length = 185 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Length = 199 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Length = 377 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Length = 287 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Length = 357 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 815
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 1e-106
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 3e-95
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-105
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 6e-96
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 6e-97
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 1e-72
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 1e-80
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 4e-66
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 9e-56
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 3e-50
d1e32a394 d.31.1.1 (A:107-200) Membrane fusion atpase p97 do 2e-50
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 1e-40
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 6e-32
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-37
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 5e-34
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 5e-37
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-31
d1e32a186 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-t 5e-35
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-25
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 2e-24
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-23
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-21
d1cz5a294 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VA 7e-22
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 4e-21
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 8e-20
d1cz5a191 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT- 1e-20
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 1e-16
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 2e-16
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 2e-13
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 6e-12
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 6e-13
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 1e-11
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 2e-08
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 1e-06
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 2e-07
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 4e-06
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 4e-06
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.002
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 1e-05
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 2e-05
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 2e-05
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 3e-04
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 1e-04
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 1e-04
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.004
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 2e-04
d2gnoa2198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 2e-04
d2gnoa2198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 0.002
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 4e-04
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 4e-04
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 7e-04
d1iqpa2231 c.37.1.20 (A:2-232) Replication factor C {Archaeon 4e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 5e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 0.002
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 7e-04
d2i3ba1189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 7e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.001
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 0.001
d2bdta1176 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B 0.002
d1sxjd2237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 0.002
d1zaka1189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 0.002
d1viaa_161 c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact 0.003
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.004
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 0.004
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.004
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Thermus thermophilus [TaxId: 274]
 Score =  324 bits (831), Expect = e-106
 Identities = 102/236 (43%), Positives = 147/236 (62%), Gaps = 1/236 (0%)

Query: 481 EVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAK 540
           E P V+++D+ G +  K EL+E V++ +++P +F + G    KGVL  GPPG GKT LA+
Sbjct: 2   EAPKVTFKDVAGAEEAKEELKEIVEF-LKNPSRFHEMGARIPKGVLLVGPPGVGKTHLAR 60

Query: 541 AIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSS 600
           A+A E +  FI+  G + + M+ G   A VR++F+ A++ APC++F DE+D++  +RGS 
Sbjct: 61  AVAGEARVPFITASGSDFVEMFVGVGAARVRDLFETAKRHAPCIVFIDEIDAVGRKRGSG 120

Query: 601 TGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDPALLRPGRLDQLIYIPLPD 660
            G      ++ LNQLL EMDG      + ++ ATNRPDI+DPALLRPGR D+ I I  PD
Sbjct: 121 VGGGNDEREQTLNQLLVEMDGFEKDTAIVVMAATNRPDILDPALLRPGRFDRQIAIDAPD 180

Query: 661 EASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEK 716
              R QI +   R  P++ DVDL+ LA+ T GF GAD+  +   A   A RE   K
Sbjct: 181 VKGREQILRIHARGKPLAEDVDLALLAKRTPGFVGADLENLLNEAALLAAREGRRK 236


>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 94 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 231 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query815
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 100.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.96
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.95
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.94
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.93
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.92
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.92
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.89
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.86
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.84
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.82
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.81
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.8
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.78
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.77
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.75
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.75
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.73
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.72
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.72
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.71
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 99.71
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.71
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.71
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.69
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.69
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.69
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.69
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.68
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.68
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.67
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.66
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.65
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.63
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.62
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.62
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.61
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.61
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.6
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.59
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.57
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.55
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.55
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.54
d1e32a394 Membrane fusion atpase p97 domain 2, P97-Nc {Mouse 99.5
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.5
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.48
d1cz5a191 N-terminal domain of VAT-N, VAT-Nn {Archaeon Therm 99.46
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.45
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.45
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.42
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.37
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.31
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.22
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.18
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.06
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.03
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.03
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.96
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.95
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.71
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.71
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.65
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.65
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.64
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.63
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.6
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.6
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.59
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.51
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.51
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.51
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.5
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 98.48
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.48
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 98.47
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 98.42
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 98.41
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.39
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 98.37
d2hyda1255 Putative multidrug export ATP-binding/permease pro 98.3
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 98.29
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 98.27
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 98.25
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 98.18
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.18
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.15
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.15
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.14
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.12
d1cz5a294 C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm 98.11
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 98.08
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.07
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.07
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.03
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 98.02
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 98.0
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.99
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.97
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.97
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.95
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.93
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.9
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.89
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.89
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.89
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.88
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.87
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.87
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.86
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.85
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.84
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.8
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.8
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.78
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.78
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.77
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.76
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 97.76
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.75
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.74
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.73
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.73
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.72
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.72
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.69
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.67
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.66
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.66
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.66
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.65
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.65
d2qy9a2211 GTPase domain of the signal recognition particle r 97.64
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.64
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.63
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.62
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.62
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.61
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.61
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.61
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.6
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.6
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.6
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.6
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.58
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.58
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.57
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.56
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.54
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.54
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.53
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.51
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.51
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.51
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.5
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.5
d1okkd2207 GTPase domain of the signal recognition particle r 97.5
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.5
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.46
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.45
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.45
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.44
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.43
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.42
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.42
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.42
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.41
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.41
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.41
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.4
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.4
d1vmaa2213 GTPase domain of the signal recognition particle r 97.39
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.39
d2qy9a2211 GTPase domain of the signal recognition particle r 97.39
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.39
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.39
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.38
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.36
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.34
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.34
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.33
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.33
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.32
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.32
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.3
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 97.3
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.29
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.29
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.27
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.27
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.25
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.22
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.2
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.19
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.12
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.11
d1vmaa2213 GTPase domain of the signal recognition particle r 97.09
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 97.09
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.08
d1okkd2207 GTPase domain of the signal recognition particle r 97.07
d1qcsa186 N-terminal domain of NSF-N, NSF-Nn {Hamster (Crice 97.06
d1cr5a182 N-terminal domain of NSF-N, NSF-Nn {Baker's yeast 97.02
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.98
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.97
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.95
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.93
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.9
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.88
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.84
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.81
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.8
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.78
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.75
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.73
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.71
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.68
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.67
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.63
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.63
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.6
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.6
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.57
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.55
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.51
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 96.48
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.46
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.45
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.43
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.4
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.38
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.31
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.3
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.27
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.27
d2iv2x1151 Formate dehydrogenase H {Escherichia coli [TaxId: 96.24
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.23
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.22
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.21
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.2
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.18
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 96.17
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 96.16
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.16
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.13
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.13
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 96.09
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.08
d1eu1a1155 Dimethylsulfoxide reductase (DMSO reductase) {Rhod 96.07
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.04
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.04
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 96.0
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.98
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.97
d1ogya1120 Periplasmic nitrate reductase alpha chain, NapA {R 95.95
d1g8ka1143 Arsenite oxidase large subunit {Alcaligenes faecal 95.93
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.86
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.84
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.84
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.8
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.79
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.78
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 95.77
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.76
d2jioa1123 Periplasmic nitrate reductase alpha chain, NapA {D 95.75
d1vlfm1147 Transhydroxylase alpha subunit, AthL {Pelobacter a 95.75
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 95.74
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.74
d1tmoa1167 Trimethylamine N-oxide reductase {Shewanella massi 95.73
d1y5ia1170 Respiratory nitrate reductase 1 alpha chain {Esche 95.67
d1nrjb_209 Signal recognition particle receptor beta-subunit 95.63
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.62
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.6
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.57
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.56
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.55
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.53
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.53
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.49
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.4
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.39
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 95.32
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 95.31
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 95.31
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.3
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.29
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.28
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.27
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 95.23
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.19
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 95.18
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.17
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.16
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.15
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 95.12
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.09
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.09
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.08
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.07
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.06
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.06
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.04
d1kqfa1165 Formate dehydrogenase N, alpha subunit {Escherichi 95.03
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 95.03
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 95.03
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.02
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.01
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 95.01
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.97
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.88
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.87
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 94.86
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.85
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 94.83
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.81
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 94.79
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.76
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.7
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.7
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.69
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.68
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.66
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.66
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.64
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 94.63
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.6
d1h0ha1165 Tungsten containing formate dehydrogenase, large s 94.59
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 94.56
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.54
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.54
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.52
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.47
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.42
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.4
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.33
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.32
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 94.27
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.25
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.24
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.23
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 94.22
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.19
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 94.16
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.15
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.13
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.12
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.07
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 94.04
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 94.0
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.97
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.96
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 93.96
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.94
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.94
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.92
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.92
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.92
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 93.91
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.91
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 93.9
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.89
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 93.87
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.87
d2fug3182 NADH-quinone oxidoreductase chain 3, Nqo3, C-termi 93.86
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.86
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.79
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.78
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.74
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 93.74
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.65
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.65
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 93.61
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.6
d1wlfa287 Peroxisome biogenesis factor 1 (PEX-1), N-terminal 93.58
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.55
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.53
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.52
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.48
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 93.45
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.42
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.41
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.39
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.37
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.37
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 93.35
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 93.34
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.3
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 93.26
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 93.25
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.22
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.2
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.17
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.17
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.17
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.16
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 93.14
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.14
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 93.12
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.1
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 93.05
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 93.0
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 93.0
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.98
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.98
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.96
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.95
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.95
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.93
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.92
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.85
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 92.83
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 92.82
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 92.82
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 92.82
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.8
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.8
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 92.77
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.74
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.71
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 92.59
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 92.55
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 92.55
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.53
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 92.51
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.42
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 92.41
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 92.38
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 92.34
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 92.27
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 92.26
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.24
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 92.18
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.12
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 92.03
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 91.93
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.92
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.92
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 91.91
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 91.89
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 91.88
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 91.73
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 91.69
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 91.67
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 91.66
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 91.66
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 91.59
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.59
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 91.57
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.5
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 91.47
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 91.39
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 91.37
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 91.32
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 91.29
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 91.25
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.22
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.22
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 91.17
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 91.05
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 91.04
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 91.0
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.8
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 90.73
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 90.64
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 90.55
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 90.54
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.46
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 90.45
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 90.39
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.34
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.28
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 90.22
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 90.2
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 90.13
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 89.98
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 89.94
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 89.88
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 89.61
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 89.52
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 89.51
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.47
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 89.46
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 89.41
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 89.26
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.16
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 89.15
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.03
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.96
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 88.86
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 88.83
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 88.8
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 88.62
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=359.09  Aligned_cols=249  Identities=41%  Similarity=0.788  Sum_probs=231.9

Q ss_pred             CCCCCCCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHHHHHHCCCEEEEECCCHHH
Q ss_conf             25886411124540112110000247777925665206889851377679998736999999998079089982510001
Q 003499          481 EVPNVSWEDIGGLDNVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLT  560 (815)
Q Consensus       481 ~~~~~~~~~i~g~~~~k~~L~~~i~~~~~~~~~~~~~~~~~~~giLL~GppGtGKT~la~aia~~~~~~~i~v~~~~l~~  560 (815)
                      ..+.++|+||+|++++|+.|.+.+.+ +.+++.|.+++..+++|+|||||||||||++|+++|++++.+++.++++++.+
T Consensus         5 ~~~~~t~~Di~Gl~~~k~~l~e~v~~-~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~~~~~~~i~~~~l~~   83 (256)
T d1lv7a_           5 DQIKTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVE   83 (256)
T ss_dssp             CSSCCCGGGSCSCHHHHHHTHHHHHH-HHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHHTCCEEEECSCSSTT
T ss_pred             CCCCCCHHHHHCHHHHHHHHHHHHHH-HHCHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEEEHHHHHH
T ss_conf             89998999981639999999999999-87999999869998886786689988822899999998299879988699426


Q ss_pred             HCCCCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCCCC
Q ss_conf             10176378899999998608993999935102331059988999841899999997600047889848999943899999
Q 003499          561 MWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGSSTGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDII  640 (815)
Q Consensus       561 ~~~g~se~~i~~vf~~a~~~~p~ilfiDEid~l~~~r~~~~~~~~~~~~~v~~~lL~~ld~~~~~~~v~vI~aTn~~~~l  640 (815)
                      +|+|+++++++.+|+.|++..||||||||+|.+++.|+...........+++++||++||++...++++||||||+|+.|
T Consensus        84 ~~~g~~~~~l~~~f~~A~~~~P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~vIatTn~~~~l  163 (256)
T d1lv7a_          84 MFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVL  163 (256)
T ss_dssp             SCCCCCHHHHHHHHHHHHTTCSEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEEEEEEESCTTTS
T ss_pred             CCHHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCC
T ss_conf             00107899999999999975998999977566575678988887489999999999995387777998999807993107


Q ss_pred             CCCCCCCCCCCCEEECCCCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             94445989775213206999999999999971139999843489999984899999999999999999999987987999
Q 003499          641 DPALLRPGRLDQLIYIPLPDEASRLQIFKACLRKSPISPDVDLSALARYTHGFSGADITEVCQRACKYAIRENIEKDIER  720 (815)
Q Consensus       641 d~allr~gRf~~~i~~~~p~~~~r~~Il~~~~~~~~~~~~~~~~~la~~t~g~sg~di~~l~~~a~~~a~~~~~~~~~~~  720 (815)
                      |++++|||||+..|+|++|+.++|.+||+.++++.++..++++..+++.|.||+|+||.++|++|+..|+++.       
T Consensus       164 d~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adi~~l~~~A~~~a~~~~-------  236 (256)
T d1lv7a_         164 DPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGN-------  236 (256)
T ss_dssp             CGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSCBCTTCCHHHHHHTCTTCCHHHHHHHHHHHHHHHHHTT-------
T ss_pred             CHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCC-------
T ss_conf             9857689878779877995999999999984259986865699999986899899999999999999999828-------


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             98520797434323433432234888999996516
Q 003499          721 ERRKRENPEAMEEDEVDDVAEIKAVHFEESMKYAR  755 (815)
Q Consensus       721 ~~~~~~~~~~~~~~~~~~~~~i~~~~f~~al~~~~  755 (815)
                                        ...|+++||++|++.+-
T Consensus       237 ------------------~~~i~~~d~~~Al~rv~  253 (256)
T d1lv7a_         237 ------------------KRVVSMVEFEKAKDKIM  253 (256)
T ss_dssp             ------------------CSSBCHHHHHHHHHHHT
T ss_pred             ------------------CCCCCHHHHHHHHHHHH
T ss_conf             ------------------98348999999999996



>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1cr5a1 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogya1 b.52.2.2 (A:682-801) Periplasmic nitrate reductase alpha chain, NapA {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1g8ka1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2jioa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1vlfm1 b.52.2.2 (M:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1tmoa1 b.52.2.2 (A:632-798) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]} Back     information, alignment and structure
>d1y5ia1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kqfa1 b.52.2.2 (A:851-1015) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1h0ha1 b.52.2.2 (A:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wlfa2 b.52.2.3 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure