BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003501
         (815 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1CQ3|A Chain A, Structure Of A Soluble Secreted Chemokine Inhibitor, Vcci,
           From Cowpox Virus
 pdb|1CQ3|B Chain B, Structure Of A Soluble Secreted Chemokine Inhibitor, Vcci,
           From Cowpox Virus
          Length = 233

 Score = 30.0 bits (66), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 3/46 (6%)

Query: 619 KNQPLIILNLMHEKVPLLMAEDLSGTSNMEQKCLQALSIRPFPGDL 664
           K  P++  N+ H+KV     ED+ G++ ++ KC++ L I    GD+
Sbjct: 151 KTHPVLGSNISHKKVSY---EDIIGSTIVDTKCVKNLEISVRIGDM 193


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.369 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,500,404
Number of Sequences: 62578
Number of extensions: 758775
Number of successful extensions: 1502
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1501
Number of HSP's gapped (non-prelim): 2
length of query: 815
length of database: 14,973,337
effective HSP length: 107
effective length of query: 708
effective length of database: 8,277,491
effective search space: 5860463628
effective search space used: 5860463628
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 56 (26.2 bits)