BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 003501
(815 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1CQ3|A Chain A, Structure Of A Soluble Secreted Chemokine Inhibitor, Vcci,
From Cowpox Virus
pdb|1CQ3|B Chain B, Structure Of A Soluble Secreted Chemokine Inhibitor, Vcci,
From Cowpox Virus
Length = 233
Score = 30.0 bits (66), Expect = 5.0, Method: Compositional matrix adjust.
Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 3/46 (6%)
Query: 619 KNQPLIILNLMHEKVPLLMAEDLSGTSNMEQKCLQALSIRPFPGDL 664
K P++ N+ H+KV ED+ G++ ++ KC++ L I GD+
Sbjct: 151 KTHPVLGSNISHKKVSY---EDIIGSTIVDTKCVKNLEISVRIGDM 193
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.130 0.369
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,500,404
Number of Sequences: 62578
Number of extensions: 758775
Number of successful extensions: 1502
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 1501
Number of HSP's gapped (non-prelim): 2
length of query: 815
length of database: 14,973,337
effective HSP length: 107
effective length of query: 708
effective length of database: 8,277,491
effective search space: 5860463628
effective search space used: 5860463628
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 56 (26.2 bits)