Citrus Sinensis ID: 003504


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-----
MSSKSFQASYFSASFCSWRGVVCDSNKQHVTDFLASNSGLSGSVPDTTIGKLSKLQSLDLSENNITALPSDLWSLGSLKSLNLSYNRISGSLPSNIGNFGLLEVFDLSNNNFSGEIPAAISSLVSLRVLKLDGNMFQWSIPPGLLNCQSLVTVDLSMNQLNGSLPDGFGAAFPKLKSLNLAGNEIKGRDTHFAGLKSITNLNISGNLFQGSVMGVFLESLEVIDLRSNQFQGHISQVQFNSSYNWSRLVYVDLSENQLSGEIFHNFSQAQNLKHLSLAYNRFTRQEFPQIGTLLGLEHLNLSRTSLIGDIPSEILQLSSLHTLDLSMNHLTGQIPTVSAKNLGIIDMSHNNLSGEIPASLLEKLPQMERFNFSYNNLTLCASELSPETLQTAFFGSSNDCPIAANPSFFKRKAANHKGLKLALALTLSMICLLAGLLCLAFGCRRKPKRWVVKQTSYKEEQNVSGPFSFQTDSTTWVADVKHANSVQVVIFEKPLLNITFADLLSATSNFDRGTLLAEGKFGPVYRGFLPGGIHVAVKVLVHGSTLTDQEAARELEYLGRIKHPNLVPLTGYCIAGDQRIAIYDYMENGNLQNLLHDLPLGVQTTEDWSTDTWEEDGTNSIQNVGSEGLLTTWRFRHKIALGTARALAFLHHGCSPPIIHRDIKASSVYLDMNLEPRLSDFGLAKIFGNGLDEEIARGSPGYIPPEFAQPDSDFPTPKSDVYCYGVVLLELITGKKPLGDDYPEEKEGNLVSWVRGLVRNNKGSRAIDPKIRDTGPEKQMEEALKIGYLCTADLPLKRPSMQQIVGLLKDIESTA
cccccccccccccccccccCEECccccccccEEEccccccCECcccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccCEECcccHHHHccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHHHccccccEEEccccccccccccccccccccEEEcccccccccccHHHHHcccEEEcccccccccccHHHHHcccccccccEEEcccccccccccHHHHccccccEEEcccccccccccHHHccccccccEEcccccccccccHHHcccccccEEEcccccccccccHHcccccccEEcccccccccccHHHHHcccccccEEccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccHHHcccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHcccccccEEcccccccEEEEEcccccEEEEEEEcccccccHHHHHHHHHHHccccccccccEEEEECcccCEEEEEcccccccHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccCEccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccECcccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccc
****SFQASYFSASFCSWRGVVCDSNKQHVTDFLASNSGLSGSVPDTTIGKLSKLQSLDLSENNITALPSDLWSLGSLKSLNLSYNRISGSLPSNIGNFGLLEVFDLSNNNFSGEIPAAISSLVSLRVLKLDGNMFQWSIPPGLLNCQSLVTVDLSMNQLNGSLPDGFGAAFPKLKSLNLAGNEIKGRDTHFAGLKSITNLNISGNLFQGSVMGVFLESLEVIDLRSNQFQGHISQVQFNSSYNWSRLVYVDLSENQLSGEIFHNFSQAQNLKHLSLAYNRFTRQEFPQIGTLLGLEHLNLSRTSLIGDIPSEILQLSSLHTLDLSMNHLTGQIPTVSAKNLGIIDMSHNNLSGEIPASLLEKLPQMERFNFSYNNLTLCASELSPETLQTAFFGSSNDCPIAANPSFFKRKAANHKGLKLALALTLSMICLLAGLLCLAFGCRRKPKRWVVKQTSYKEEQNVSGPFSFQTDSTTWVADVKHANSVQVVIFEKPLLNITFADLLSATSNFDRGTLLAEGKFGPVYRGFLPGGIHVAVKVLVHGSTLTDQEAARELEYLGRIKHPNLVPLTGYCIAGDQRIAIYDYMENGNLQNLLHDLPLGVQTTEDWSTDTWEEDGTNSIQNVGSEGLLTTWRFRHKIALGTARALAFLHHGCSPPIIHRDIKASSVYLDMNLEPRLSDFGLAKIFGNGLDEEIARGSPGYIPPEFAQPDSDFPTPKSDVYCYGVVLLELITGKKPLGDDYPEEKEGNLVSWVRGLVR**K**RAIDPKIRDTGPEKQMEEALKIGYLCTADLPLKRPSMQQIVGLLKDIES**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKSFQASYFSASFCSWRGVVCDSNKQHVTDFLASNSGLSGSVPDTTIGKLSKLQSLDLSENNITALPSDLWSLGSLKSLNLSYNRISGSLPSNIGNFGLLEVFDLSNNNFSGEIPAAISSLVSLRVLKLDGNMFQWSIPPGLLNCQSLVTVDLSMNQLNGSLPDGFGAAFPKLKSLNLAGNEIKGRDTHFAGLKSITNLNISGNLFQGSVMGVFLESLEVIDLRSNQFQGHISQVQFNSSYNWSRLVYVDLSENQLSGEIFHNFSQAQNLKHLSLAYNRFTRQEFPQIGTLLGLEHLNLSRTSLIGDIPSEILQLSSLHTLDLSMNHLTGQIPTVSAKNLGIIDMSHNNLSGEIPASLLEKLPQMERFNFSYNNLTLCASELSPETLQTAFFGSSNDCPIAANPSFFKRKAANHKGLKLALALTLSMICLLAGLLCLAFGCRRKPKRWVVKQTSYKEEQNVSGPFSFQTDSTTWVADVKHANSVQVVIFEKPLLNITFADLLSATSNFDRGTLLAEGKFGPVYRGFLPGGIHVAVKVLVHGSTLTDQEAARELEYLGRIKHPNLVPLTGYCIAGDQRIAIYDYMENGNLQNLLHDLPLGVQTTEDWSTDTWEEDGTNSIQNVGSEGLLTTWRFRHKIALGTARALAFLHHGCSPPIIHRDIKASSVYLDMNLEPRLSDFGLAKIFGNGLDEEIARGSPGYIPPEFAQPDSDFPTPKSDVYCYGVVLLELITGKKPLGDDYPEEKEGNLVSWVRGLVRNNKGSRAIDPKIRDTGPEKQMEEALKIGYLCTADLPLKRPSMQQIVGLLKDIESTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable LRR receptor-like serine/threonine-protein kinase At2g24230 confidentC0LGK9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 34-378
View the alignment between query and template
View the model in PyMOL
Template: 2QKW, chain B
Confidence level:very confident
Coverage over the Query: 499-610,636-811
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:confident
Coverage over the Query: 36-378
View the alignment between query and template
View the model in PyMOL
Template: 2ID5, chain A
Confidence level:confident
Coverage over the Query: 56-412
View the alignment between query and template
View the model in PyMOL
Template: 3VHE, chain A
Confidence level:confident
Coverage over the Query: 628-743,756-811
View the alignment between query and template
View the model in PyMOL
Template: 2ACX, chain A
Confidence level:confident
Coverage over the Query: 447-596,621-737
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:probable
Coverage over the Query: 36-378
View the alignment between query and template
View the model in PyMOL