Citrus Sinensis ID: 003562


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810
MMFSLENGPAGVCRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVSQRYLVSVSGNDGKRVLSDAWALDTAQKPYVWQRLNPEGDRPSARMYATASARSDGMFLLCGGRDASGAPLADAYGLLMHRNGQWEWTLAPGVAPSPRYQHAAVFVGARLHVTGGALRGGRAIEGEAAVAVLDTAAGVWLDRNGLVTSSRTSKGHGEHDPSLELMRRCRHASASIGVRIYIYGGLKGDILLDDFLVAENSPFQSDVNSPLLTSERAPTHTGSKVNQTNLGYVTTPTPDGLHSPSFGSLSMDKNSMEKLREASAAEAEAANAVWQAAQAASAVPPEETSVSDDNSQVAEATSDGSDTEADVRLHPRAVVVAKEAVGNLGGMVRQLSLDQFENESRRMIPLNNELSYPTKKFTRQRSPQGLHKKIISTLLRPRNWKAPANRRFFLDSYEVGELCYAAEQIFMQEPTVLQLRAPVKVFGDLHGQFGDLMRLFDEYGFPSTAGDITYIDYLFLGDYVDRGQHSLETITLLLALKIEYPENVHLIRGNHEAADINALFGFRLECIERMGENDGIWAWTRFNQLFNCLPLAALIEKKIICMHGGIGRSIHSVEQIEKLERPITMDAGSIILMDLLWSDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPTPTRGRPQPDLDRNSLAYI
cccccccccccEEEEccccccccccHHHHHHccccEEEEEccccccccccccEEEEEcccccccEEEEEEccccccccccHHEEcccccEEEEEEccccccccccEEEEEcccccCEEEEEcccccccccccEEEEcccccccEEEEcccccccccccccEEccccccccEEEEEcccccccccccHHHHHHccccEEEccccccccccccccHHEEEEcccccEEcccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEccccEEEccccccHHHHHHHHHHccccccccccccccEEEccccccccccHHHHHHHHHHHHHcccccEEECccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHccccccEEEcccEEEEccccccccccHHHHHHcccccccccccccEEEECccccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccccccccccccEEEEEccccccccccccEEEEEEcccccEEcEEEcccccccccccccccccccHHHHHHcccccccccccccccccccccccccc
*******GPAGVCRIR***EPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVSQRYLVSVSGNDGKRVLSDAWALDTAQKPYVWQRLNPEGDRPSARMYATASARSDGMFLLCGGRDASGAPLADAYGLLMHRNGQWEWTLAPGVAPSPRYQHAAVFVGARLHVTGGALRGGRAIEGEAAVAVLDTAAGVWLDRNGLV******************MRRCRHASASIGVRIYIYGGLKGDILLDDFLVAENS****************************************************************************************************************HPRAVVVAKEAVGNLGGMVRQLSL*********************************HKKIISTLLRPRNWKAPANRRFFLDSYEVGELCYAAEQIFMQEPTVLQLRAPVKVFGDLHGQFGDLMRLFDEYGFPSTAGDITYIDYLFLGDYVDRGQHSLETITLLLALKIEYPENVHLIRGNHEAADINALFGFRLECIERMGENDGIWAWTRFNQLFNCLPLAALIEKKIICMHGGIGRSIHSVEQIEKLERPITMDAGSIILMDLLWSDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHP******************MWMQE*************************I
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMFSLENGPAGVCRIRPAGEPPSPRAAHAAAAVGTMVVFQGGIGPAGHSTDDLYVLDLTNDKFKWHRVVVQGQGPGPRYGHVMDLVSQRYLVSVSGNDGKRVLSDAWALDTAQKPYVWQRLNPEGDRPSARMYATASARSDGMFLLCGGRDASGAPLADAYGLLMHRNGQWEWTLAPGVAPSPRYQHAAVFVGARLHVTGGALRGGRAIEGEAAVAVLDTAAGVWLDRNGLVTSSRTSKGHGEHDPSLELMRRCRHASASIGVRIYIYGGLKGDILLDDFLVAENSPFQSDVNSPLLTSERAPTHTGSKVNQTNLGYVTTPTPDGLHSPSFGSLSMDKNSMEKLREASAAEAEAANAVWQAAQAASAVPPEETSVSDDNSQVAEATSDGSDTEADVRLHPRAVVVAKEAVGNLGGMVRQLSLDQFENESRRMIPLNNELSYPTKKFTRQRSPQGLHKKIISTLLRPRNWKAPANRRFFLDSYEVGELCYAAEQIFMQEPTVLQLRAPVKVFGDLHGQFGDLMRLFDEYGFPSTAGDITYIDYLFLGDYVDRGQHSLETITLLLALKIEYPENVHLIRGNHEAADINALFGFRLECIERMGENDGIWAWTRFNQLFNCLPLAALIEKKIICMHGGIGRSIHSVEQIEKLERPITMDAGSIILMDLLWSDPTENDSIEGLRPNARGPGLVTFGPDRVSDFCKRNKLQLIIRAHECVMDGFERFAQGQLITLFSATNYCGTANNAGAILVVGRGLVVVPKLIHPLPPPLQSPETSPERVIDDMWMQELNIQRPPTPTRGRPQPDLDRNSLAYI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein phosphatase BSL1 homolog confidentQ60EX6
Serine/threonine-protein phosphatase BSL1 Phosphatase involved in elongation process, probably by acting as a regulator of brassinolide signaling.confidentQ8L7U5

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJM, chain A
Confidence level:very confident
Coverage over the Query: 458-761,772-773
View the alignment between query and template
View the model in PyMOL
Template: 3C5W, chain C
Confidence level:confident
Coverage over the Query: 460-746
View the alignment between query and template
View the model in PyMOL
Template: 2ZWA, chain A
Confidence level:probable
Coverage over the Query: 17-270
View the alignment between query and template
View the model in PyMOL
Template: 2UVK, chain A
Confidence level:probable
Coverage over the Query: 22-270
View the alignment between query and template
View the model in PyMOL