BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003631
         (806 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3P42|A Chain A, Structure Of Gfcc (Ymcb), Protein Encoded By The E. Coli
           Group 4 Capsule Operon
 pdb|3P42|B Chain B, Structure Of Gfcc (Ymcb), Protein Encoded By The E. Coli
           Group 4 Capsule Operon
 pdb|3P42|C Chain C, Structure Of Gfcc (Ymcb), Protein Encoded By The E. Coli
           Group 4 Capsule Operon
 pdb|3P42|D Chain D, Structure Of Gfcc (Ymcb), Protein Encoded By The E. Coli
           Group 4 Capsule Operon
          Length = 236

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 551 HIKPPPSDQLWFGFTS 566
           H++PPP  QLW GF++
Sbjct: 189 HVEPPPGSQLWLGFSA 204


>pdb|1MKF|A Chain A, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus 68
 pdb|1MKF|B Chain B, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus 68
 pdb|1ML0|A Chain A, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus68 In Complex With The P8a Variant Of
           Cc-Chemokine Mcp-1
 pdb|2NYZ|A Chain A, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus68 In Complex With The C- Chemokine Xcl1
 pdb|2NYZ|B Chain B, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus68 In Complex With The C- Chemokine Xcl1
 pdb|2NZ1|A Chain A, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus68 In Complex With The Cc-Chemokine
           Ccl2MCP-1
 pdb|2NZ1|B Chain B, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus68 In Complex With The Cc-Chemokine
           Ccl2MCP-1
 pdb|2NZ1|X Chain X, Viral Chemokine Binding Protein M3 From Murine
           Gammaherpesvirus68 In Complex With The Cc-Chemokine
           Ccl2MCP-1
          Length = 382

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 97  PVRKYAKIKHRALILTSTDGSQTSFPLKGCEIKAVSASS 135
           PVR  +K+ H AL +TS DG  TS   + C I+ V   S
Sbjct: 308 PVRPSSKLYHCALQMTSHDGVWTSTSSEQCPIRLVEGQS 346


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,172,188
Number of Sequences: 62578
Number of extensions: 827525
Number of successful extensions: 1253
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 1251
Number of HSP's gapped (non-prelim): 5
length of query: 806
length of database: 14,973,337
effective HSP length: 107
effective length of query: 699
effective length of database: 8,277,491
effective search space: 5785966209
effective search space used: 5785966209
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 55 (25.8 bits)