BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003638
         (806 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3CSR|A Chain A, Crystal And Cryoem Structural Studies Of A Cell Wall
           Degrading Enzyme In The Bacteriophage Phi29 Tail
 pdb|3CSZ|A Chain A, Crystal And Cryoem Structural Studies Of A Cell Wall
           Degrading Enzyme In The Bacteriophage Phi29 Tail
 pdb|3CT0|A Chain A, Crystal And Cryoem Structural Studies Of A Cell Wall
           Degrading Enzyme In The Bacteriophage Phi29 Tail
 pdb|3CT1|A Chain A, Crystal And Cryoem Structural Studies Of A Cell Wall
           Degrading Enzyme In The Bacteriophage Phi29 Tail
 pdb|3CT5|A Chain A, Crystal And Cryoem Structural Studies Of A Cell Wall
           Degrading Enzyme In The Bacteriophage Phi29 Tail
          Length = 159

 Score = 30.0 bits (66), Expect = 5.8,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 564 ESIKSISLEAYNWILQSEYLNWANAFFQGARYNHMTSNFGELFYSWASDANELPITQM 621
           E   S+      W   S Y+NWAN+  QG  Y +M S    + +   ++A  + +  M
Sbjct: 58  EGNTSLGFGLVQWTPASNYINWANS--QGLPYKNMDSELKRIIWEVNNNAQWINLRDM 113


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.135    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 22,247,129
Number of Sequences: 62578
Number of extensions: 870927
Number of successful extensions: 1935
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1935
Number of HSP's gapped (non-prelim): 2
length of query: 806
length of database: 14,973,337
effective HSP length: 107
effective length of query: 699
effective length of database: 8,277,491
effective search space: 5785966209
effective search space used: 5785966209
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)