Citrus Sinensis ID: 003672


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800----
MASRNQNRPPRSPSIKKEGTDDVPFDKRRRIGAGRTTGATSTGTGRPRQAFAVVNNRQDVSAASDMASTEGSDCGTIEFTKEEVEALLNEKPKTKKFDLKAKIEQMTEHNKRFKLCIKWFQQVDENHVLEKQKIQSALESTEKKLSDTEMEMKNRESELNGTILDLRQENAHLREKVAKEESEKLDAIENHRIEKEARVAAEKLQASLSEQLEKAHQDIAAANQRAVSLDDMYKRLQEYNQSLQLYNAKLQSDLETANEVNKRVEKEKLTIVENLSTLRGHNNSLQEQLALSRASQDEATKQKDSLVNEVRCLRGELQQVRDDRDRQVAQVQTLTAEIVKYQESTGKSLMELNSLTTKSKSLEETCSSQREQIRIMEIQLAAANEKLKMADLSSMETRAEFEEKQRVAQELQERLAEAEHQLIEGEKLRKKLHNTILELKGNIRVFCRVRPLLPDDGVGADASIISYPTSLESQGRGIDLIQNGQKFPFTFDKVFNHEASQQDVFLEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPEAQEHKGLIPRSLEQIFQTSQFLLVQGWKFKMQASMLEIYNETIRDLLSTSRAGGSDLTRTENGVPGKQYAIKHDANGNTHVSDLTIVDVCSISEISSLLRQAAQSRSVGKTQMNEYSSRSHFVFTLRIFGVNEATEQQVQGVLNLIDLAGSERLSRSGATGDRLKETQAINKSLSSLSDVIFALAKKEDHIPYRNSKLTYLLQPCLGRDSKTLMFVNISPDSPSVGESLCSLRFAARVNACEIGVPSRQLTLKAADSRLSYG
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccEEEccccccccccccccccccccccEEccccccccccHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEccccccccccccccccccccccccccccccCEEEcccccEEEcccEEEEcccHHHHHHHHHHHHcccHHHcccccccccccccEEEEEEEEEEcccccEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHcccccccccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccccccccc
*********************************************************************************************************MTEHNKRFKLCIKWFQQVDENHVL******************************************************************************************************MYKRLQEYNQSLQLYNA**************************************************************RCL****QQVRDDRDRQVAQVQTLTAEIVK****************TKSKSLEETCSSQREQIRIMEIQLAAANEKLKMADLSSMETRAEFEEKQRVAQELQERLAEAEHQLIEGEKLRKKLHNTILELKGNIRVFCRVRPLLPDDGVGADASIISYPTSLESQGRGIDLIQNGQKFPFTFDKVFNHEASQQDVFLEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPEAQEHKGLIPRSLEQIFQTSQFLLVQGWKFKMQASMLEIYNETIRDLLSTSRAGGS*********PGKQYAIKHDANGNTHVSDLTIVDVCSISEISSLLRQAAQSRSVGKTQ*NEYSSRSHFVFTLRIFGVNEATEQQVQGVLNLIDLAGSERLS*****GDRLKETQAINKSLSSLSDVIFALAKKEDHIPYRNSKLTYLLQPCLGRDSKTLMFVNISPDSPSVGESLCSLRFAARVNACEIG******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASRNQNRPPRSPSIKKEGTDDVPFDKRRRIGAGRTTGATSTGTGRPRQAFAVVNNRQDVSAASDMASTEGSDCGTIEFTKEEVEALLNEKPKTKKFDLKAKIEQMTEHNKRFKLCIKWFQQVDENHVLExxxxxxxxxxxxxxxxxxxxxxxxxxxxLNGTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVAAEKLxxxxxxxxxxxxxxxxxxxxxAVSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLTIVENLSTLRGHNNSLQEQLALSRASxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVKYQESTGKSLMExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLKMADLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRKKLHNTILELKGNIRVFCRVRPLLPDDGVGADASIISYPTSLESQGRGIDLIQNGQKFPFTFDKVFNHEASQQDVFLEISQLVQSALDGYKVCIFAYGQTGSGKTYTMMGKPEAQEHKGLIPRSLEQIFQTSQFLLVQGWKFKMQASMLEIYNETIRDLLSTSRAGGSDLTRTENGVPGKQYAIKHDANGNTHVSDLTIVDVCSISEISSLLRQAAQSRSVGKTQMNEYSSRSHFVFTLRIFGVNEATEQQVQGVLNLIDLAGSERLSRSGATGDRLKETQAINKSLSSLSDVIFALAKKEDHIPYRNSKLTYLLQPCLGRDSKTLMFVNISPDSPSVGESLCSLRFAARVNACEIGVPSRQLTLKAADSRLSYG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kinesin-1 Kinesin that supports microtubule movement in an ATP-dependent manner and has a minus-end directed polarity. Plays a crucial role in spindle morphogenesis in male Arabidopsis meiosis.confidentQ07970

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ETP, chain A
Confidence level:very confident
Coverage over the Query: 410-591,606-783
View the alignment between query and template
View the model in PyMOL
Template: 3U06, chain A
Confidence level:very confident
Coverage over the Query: 383-595,609-695,710-785
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 99-152
View the alignment between query and template
View the model in PyMOL
Template: 2XS1, chain A
Confidence level:probable
Coverage over the Query: 114-450
View the alignment between query and template
View the model in PyMOL