Citrus Sinensis ID: 003688


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800---
MVGEEDNNKHVDRLSGGSGNRRAYLRSVSWTDRSPNKPNPIPRPQPNSKARSLLPPLQPLSINRRPVEQWPRAGSDDLGVWPNPQTPRGSVQLNPLESSSSELQPVKEFEFKKDKLAFFDKECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRVHAMPASPNSMLRIYRIAPHSSYDPLHLVPKLLNYPVAQGFDTRGAFIVLVPSAIYVWIGKNCSVMMSNRAREAANQVIRYEKAQGQITSIKEGEEPLEFWDALVRGQFFADGCNKEEVKNEQVSFSGSNKIATLMQDGAGEIDEYDLDFELFHKALDGGVVPPFSVSNAGSETCVPARESGWCRLRRKFVNGLMREFVASKLNCATSAVNDESNMIIDTGKASEDAVSLAGFASPSSPPADVCGSPDSFDCFPNVSPNRISSPQLSSKSPTLSPSTSDYSSSFTFSPSSCNWSDLSRQPSPSGLEATDSSHSLCEETAFSLSKVFSPNHTSGVANSCFPCKGNFPSIAERRGSNPPPRLLPSAGKPSIVPRNLVRSWSFSLTDLENDEVKDMDNNQIVHEGDREELMLNADLACASNDSHDKIKDKKEYDRVHFSLGTIDKRMGVANPVLYQWPALSKVESSSFQVLDSRSVYILLAPDTSLGQMSRVFCMSGWGVKFCVKKGRVNWSATIVLASMVIFSWRPSVTTLLIKWVCQRMRLFR
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEECccEEEccHHHHccHHHHHHccccEEEEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccHHcccccccccccccccccccccccccccccccCEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccEEEEEccccccccccccEEEEcccccHHHcccccccccccEEEEEcccccccccccEEEEEcccEEEEEEcccEEccccEEEEEEEEEEEcccHHHHHHHHHHHHHHccc
**************************************************************************************************************FKKDKLAFFDKECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRVHAM******************YDPLHLVPKLLNYPVAQGFDTRGAFIVLVPSAIYVWIGKNCSVMMSNRAREAANQVIRYEKAQGQITSIKEGEEPLEFWDALVRGQFFADGCNKEEV*********************GEIDEYDLDFELFHKALDGGVVPPFS*******TCVPARESGWCRLRRKFVNGLMREFVASKLNCATSAVN*****I*****************************************************************************************************************************************************************SFSLT*********************************************EYDRVHFSLGTIDKRMGVANPVLYQWPALSKVESSSFQVLDSRSVYILLAPDTSLGQMSRVFCMSGWGVKFCVKKGRVNWSATIVLASMVIFSWRPSVTTLLIKWVCQRMRLFR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGEEDNNKHVDRLSGGSGNRRAYLRSVSWTDRSPNKPNPIPRPQPNSKARSLLPPLQPLSINRRPVEQWPRAGSDDLGVWPNPQTPRGSVQLNPLESSSSELQPVKEFEFKKDKLAFFDKECSRIADHIYLGSDAVAKNRGILRQNGITHVLNCVGFVCPEYFKGDLVYKTLWLQDSPSEDITSILYDVFDYFEDVREQGGRVFVHCCQGVSRSTSLVIAYLMWREGQSFEDAFQYVKAARGVTNPNMGFACQLLLCQKRVHAMPASPNSMLRIYRIAPHSSYDPLHLVPKLLNYPVAQGFDTRGAFIVLVPSAIYVWIGKNCSVMMSNRAREAANQVIRYEKAQGQITSIKEGEEPLEFWDALVRGQFFADGCNKEEVKNEQVSFSGSNKIATLMQDGAGEIDEYDLDFELFHKALDGGVVPPFSVSNAGSETCVPARESGWCRLRRKFVNGLMREFVASKLNCATSAVNDESNMIIDTGKASEDAVSLAGFASPSSPPADVCGSPDSFDCFPNVSPNRISSPQLSSKSPTLSPSTSDYSSSFTFSPSSCNWSDLSRQPSPSGLEATDSSHSLCEETAFSLSKVFSPNHTSGVANSCFPCKGNFPSIAERRGSNPPPRLLPSAGKPSIVPRNLVRSWSFSLTDLENDEVKDMDNNQIVHEGDREELMLNADLACASNDSHDKIKDKKEYDRVHFSLGTIDKRMGVANPVLYQWPALSKVESSSFQVLDSRSVYILLAPDTSLGQMSRVFCMSGWGVKFCVKKGRVNWSATIVLASMVIFSWRPSVTTLLIKWVCQRMRLFR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OUD, chain A
Confidence level:very confident
Coverage over the Query: 120-289
View the alignment between query and template
View the model in PyMOL
Template: 2PQ5, chain A
Confidence level:confident
Coverage over the Query: 103-264
View the alignment between query and template
View the model in PyMOL
Template: 1D0N, chain A
Confidence level:probable
Coverage over the Query: 302-384
View the alignment between query and template
View the model in PyMOL
Template: 3FG7, chain A
Confidence level:probable
Coverage over the Query: 379-412
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1twf, chain Aprobable Alignment | Template Structure