Citrus Sinensis ID: 003801

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790----

MKTQPPTEKMATAAAFENLNTAGVEGGQDPESLTVPLLSHQRSRSSISNSTSQVALVGADVCPIESLDYEIAENDFFKEDWRTRGRNQMIQYIFMKWSLCFLIGLIVGLIGFLNNLAVENIAGTKFVVTSNMMLANKFGMAFLSFSIPNLVLTLFASIVTATVAPVAAGSGIPEVKAYLNGVDAPGILSFRTLVIKIIGSISAVSSSLLVGKAGPMVHTGACVASLLGQGGSKKYGLTWKWLRFFKNDRDRRDFVTCGSAAGIAAAFRAPVGGLLFAIEEMASWWRSALLWRAFFTTAIVAILLRAFIDICKSGKCGLFGTGGLIMYDVYSADASYHLADVPLVLLLGVVGGILGSLYNFLLDKVLRIYNFINEKGIAPKIFLACTISILTSCLLFGLPWLASCRPCPSDASEACPTIGRSGNYKKFQCAPGYYNDLASLIFNTNDDAIRNLFSKDTDKEFQHSSMLIFFVTCFSLSVLSYGIVAPAGLFVPAIVTGASYGRFVGMLVGSHSNLNHGLYAVLGAASFLGGSMRMTVSLCVIILELTNNLLLLPMIMLVLLISKTVADAFNGNIYDLIMKAKGFPYLETHVEPYMRQLTVGDVVTAPLQLFHGIEKAGNVVHVLRTTRHNGFPVIDENPLSETPILYGLILRAHLITLLKKKAFLPTPNPTVNDAFSQFSAVDFAKRGSGNGDKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFREVGLRHLLVIPKISNGSPVMGILTRHDFMPEHILALNPLLARSRWKRLRIRFPPSLKPF

ccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcEEcccccccccccEEEEEcccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccccccccHHHccccccccccHHHHcccccccccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccEEEECccccHHHHHHHHHcccccccEEECcccccccccEEEEEHHHHHHHHHHHccccccccccccccccccccHHccccccccccccccccccHHHHHHHccccccccccccEEEccccHHHHHHHHHHHcccEEEEEEcccccccEEEEEEccccHHHHHHHHcccccccHHHHcccccccccccc

*****************************************************VALVGADVCPIESLDYEIAENDFFKEDWRTRGRNQMIQYIFMKWSLCFLIGLIVGLIGFLNNLAVENIAGTKFVVTSNMMLANKFGMAFLSFSIPNLVLTLFASIVTATVAPVAAGSGIPEVKAYLNGVDAPGILSFRTLVIKIIGSISAVSSSLLVGKAGPMVHTGACVASLLGQGGSKKYGLTWKWLRFFKNDRDRRDFVTCGSAAGIAAAFRAPVGGLLFAIEEMASWWRSALLWRAFFTTAIVAILLRAFIDICKSGKCGLFGTGGLIMYDVYSADASYHLADVPLVLLLGVVGGILGSLYNFLLDKVLRIYNFINEKGIAPKIFLACTISILTSCLLFGLPWLASCRPCPSDASEACPTIGRSGNYKKFQCAPGYYNDLASLIFNTNDDAIRNLFSKDTDKEFQHSSMLIFFVTCFSLSVLSYGIVAPAGLFVPAIVTGASYGRFVGMLVGSHSNLNHGLYAVLGAASFLGGSMRMTVSLCVIILELTNNLLLLPMIMLVLLISKTVADAFNGNIYDLIMKAKGFPYLETHVEPYMRQLTVGDVVTAPLQLFHGIEKAGNVVHVLRTTRHNGFPVIDENPLSETPILYGLILRAHLITLLKKKAFLPT*********SQFSAVDFAKRGSGNGDKIEDIELSEEEMEMYVDLHPFANASPYTVVETMSLAKALILFREVGLRHLLVIPKISNGSPVMGILTRHDFMPEHILALNPLLARSRWKRLRIRF****K**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Putative chloride channel-like protein CLC-g	Putative voltage-gated chloride channel.	confident	P60300
H(+)/Cl(-) exchange transporter 7	Mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to the acidification of the lysosome lumen.	probable	P51798
H(+)/Cl(-) exchange transporter 7	Mediates the exchange of chloride ions against protons. Functions as antiporter and contributes to the acidification of the lysosome lumen.	probable	P51799

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ORG, chain A
Confidence level:very confident
Coverage over the Query: 91-306,334-400,445-644,677-690,708-769
View the alignment between query and template
View the model in PyMOL

Template: 3ND0, chain A
Confidence level:very confident
Coverage over the Query: 91-307,319-401,418-419,444-580
View the alignment between query and template
View the model in PyMOL