Citrus Sinensis ID: 003806


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790----
MSSIEFLRSTIHNRFLYANSSYNLHGGSFCHSRCRVYYHNTYRFASHAILFPSVIISNSQQKLSLKRGLLYSNQNLREIKILASSKDGESSETSESDGQSQSQTQSPTSTDSPTSQRREKRNKSNGFWWSKGKKFKWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGIPLPGSEPRTSTTFVSVPYSDFLSKINSNQVAKVEVDGVHIMFKLKNDGSIQESEVITNKFQESESLLKSVTPTKRIVYTTTRPSDIKTPYEKMLENQVEFGSPDKRSGGFLNSALIALFYVAVLAGLLHRFPVSFSQTAGQVGHRKTRGPGGAKVSEQGDTITFADVAGVDEAKEELEEIVEFLRSPDKYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGFTGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARHEAGHAVVGTAVASLLPGQPRVEKLSILPRTGGALGFTYTPANEDRYLLFIDELCGRLVTLLGGRAAEEVAYSGRISTGALDDIRRATDMAYKAIAEYGLNRTIGPVSIATLSSGGIDESGGGVPWGRDQGQLVDLVQREVKALLQSALEVALCVVRANPDVLEGLGACLEGNYVTANLVSLSLSYLIMLTSFDLWML
cccccccccccccccccccccccccccccccccccEECcccccccccccccccEEEccccccHHHHcccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHcccEEEEEEEccEEEEEEccccccccHHHHHHcccccHHHHccccccccEEEEECccccccHHHHHHHHcccEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHcccccccccEEEcccccHHHHHHHHHHccccccEEEccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccHHHHcccccHHHcccHHHccccccccEEEEEEcccccccEEEEcccccccccccHHHHHHHHHHHHccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccc
****EFLRSTIHNRFLYANSSYNLHGGSFCHSRCRVYYHNTYRFASHAILFPSVIISNSQQKLSLKRGLLYSNQNLREIKI********************************************GFWWSKGKKFKWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGIPLP*********FVSVPYSDFLSKINSNQVAKVEVDGVHIMFKLKNDGSI*****I********SLLKSVTPTKRIVYTTTRPSDIKTPYEKMLENQVEFGSPDKRSGGFLNSALIALFYVAVLAGLLHRFPVSF*********************EQGDTITFADVAGVDEAKEELEEIVEFLRSPDKYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGFTGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARHEAGHAVVGTAVASLLPGQPRVEKLSILPRTGGALGFTYTPANEDRYLLFIDELCGRLVTLLGGRAAEEVAYSGRISTGALDDIRRATDMAYKAIAEYGLNRTIGPVSIATLSSGGIDESGGGVPWGRDQGQLVDLVQREVKALLQSALEVALCVVRANPDVLEGLGACLEGNYVTANLVSLSLSYLIMLTSFDLWML
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSIEFLRSTIHNRFLYANSSYNLHGGSFCHSRCRVYYHNTYRFASHAILFPSVIISNSQQKLSLKRGLLYSNQNLREIKILASSKDGESSETSESDGQSQSQTQSPTSTDSPTSQRREKRNKSNGFWWSKGKKFKWQPIIQAQEIGVLLLQLGIVMFVMRLLRPGIPLPGSEPRTSTTFVSVPYSDFLSKINSNQVAKVEVDGVHIMFKLKNDGSIQESEVITNKFQESESLLKSVTPTKRIVYTTTRPSDIKTPYEKMLENQVEFGSPDKRSGGFLNSALIALFYVAVLAGLLHRFPVSFSQTAGQVGHRKTRGPGGAKVSEQGDTITFADVAGVDEAKEELEEIVEFLRSPDKYIRLGARPPRGVLLVGLPGTGKTLLAKAVAGEAEVPFISCSASEFVELYVGMGASRVRDLFARAKKEAPSIIFIDEIDAVAKSRDGRFRIVSNDEREQTLNQLLTEMDGFDSNSAVIVLGATNRSDVLDPALRRPGRFDRVVMVETPDKIGREAILKVHVSKKELPLAKDIDLGDIASMTTGFTGADLANLVNEAALLAGRLNKVVVEKIDFIHAVERSIAGIEKKTAKLKGSEKAVVARHEAGHAVVGTAVASLLPGQPRVEKLSILPRTGGALGFTYTPANEDRYLLFIDELCGRLVTLLGGRAAEEVAYSGRISTGALDDIRRATDMAYKAIAEYGLNRTIGPVSIATLSSGGIDESGGGVPWGRDQGQLVDLVQREVKALLQSALEVALCVVRANPDVLEGLGACLEGNYVTANLVSLSLSYLIMLTSFDLWML

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent zinc metalloprotease FTSH 9, chloroplastic Probable ATP-dependent zinc metallopeptidase.confidentQ9FIM2
ATP-dependent zinc metalloprotease FTSH 7, chloroplastic Probable ATP-dependent zinc metallopeptidase.probableQ6H6R9
ATP-dependent zinc metalloprotease FTSH 7, chloroplastic Probable ATP-dependent zinc metallopeptidase.probableQ9SD67

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R62, chain A
Confidence level:very confident
Coverage over the Query: 324-438,449-578
View the alignment between query and template
View the model in PyMOL
Template: 2DHR, chain A
Confidence level:very confident
Coverage over the Query: 321-782
View the alignment between query and template
View the model in PyMOL
Template: 3CF2, chain A
Confidence level:very confident
Coverage over the Query: 274-436,452-526,543-558
View the alignment between query and template
View the model in PyMOL