Citrus Sinensis ID: 003809


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790----
MEAFGGILVDEKAVRVENIFLEFLKSFRLDGNMGGESCYEAEIEAMRANESNTMFIDFSHVMRYNDLLQKAIADEYLRFEPYLKNACKRFVMEQNPNFISDDNPNKDINVAFFNIPFSKRLRELTTAEIGRLVSVTGVVTRTSEVRPELLQGTFKCLECGGVIKNVEQQFKYTEPTICANATCSNRTNWALLRQDSKFADWQRVRMQETSKEIPAGSLPRSLDVILRHDIVEQARAGDTVIFTGTVVVIPDILAMGSPGERAECRREASQRKSSAVGHDGVRGLRALGVRDLSYRLAFIANSVQIADGRRDTDIRNRKKDADEEDQHQFTTEEIDEIQRMRNAPDFFNKIVDSIGPTVFGHQDIKRAILLMLLGGVHKLTHEGINLRGDINVCIVGDPSCAKSQFLKYAAGIVPRSVYTSGKSSSAAGLTASVAKEPETGEFCIEAGALMLADNGICCIDEFDKMDIRDQVAIHEAMEQQTISITKAGIQATLNARTSILAAANPAGGRYDKSKPLKKHEDALAPAFTTAQLKRYIAYAKTLKPKLSLEARKLLVDSYVALRRGDTTPGSRVAYRMTVRQLEALIRLSEAIARSHLETQVHPRHVRVAVRLLKTSVISVESSEIDLSEFQEDNRDDGDGGDDGNDGNDQGDAQPRNRTPEPASGIAGNGASSANRQGKTLVISDEYFQRVTQALVMRLRQHEESVIQEGTGLAGMRQKDLIKWYVEQQNEKNTYSSMEEVKKEVSKLKAIIESLIRREGHLIVVDDGRQAAAEGEGRPSRDDRILAVAPNYVID
ccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccccccccccccccEEEEcEEEEEccccccEEEEEEEEccccccCCccCEcccEECcccccccccccccccEEEEEcccEEccccEEEEEcccccccccccccCEEEEEEcccccccccccEEEEEEEEEEccccccccccccccHHHHHccccccccccccccccccccccccccEEEEEEEEcEECcccccccccccccccccHHHHccccHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccEEEEEEcccccHHHHHHHHHHcccccEEccccccHHcccccEEEECccccccEEEEccEEEECcccEEEEcccccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccEEEEEccccccc
****GGILVDEKAVRVENIFLEFLKSFRLDGNMGGESCYEAEIEAMRANESNTMFIDFSHVMRYNDLLQKAIADEYLRFEPYLKNACKRFVMEQNPNFISDDNPNKDINVAFFNIPFSKRLRELTTAEIGRLVSVTGVVTRTSEVRPELLQGTFKCLECGGVIKNVEQQFKYTEPTICANATCSNRTNWALLRQDSKFADWQRVRMQETSKEIPAGSLPRSLDVILRHDIVEQARAGDTVIFTGTVVVIPDILAMGS*********************DGVRGLRALGVRDLSYRLAFIANSVQIA**********************FTTEEIDEIQRMRNAPDFFNKIVDSIGPTVFGHQDIKRAILLMLLGGVHKLTHEGINLRGDINVCIVGDPSCAKSQFLKYAAGIVPRSVYTSGKSSSAAGLTASVAKEPETGEFCIEAGALMLADNGICCIDEFDKMDIRDQVAIHEAMEQQTISITKAGIQATLNARTSILAAANPAGGRYDKSKPLKKHEDALAPAFTTAQLKRYIAYAKTLKPKLSLEARKLLVDSYVALRRGDTTPGSRVAYRMTVRQLEALIRLSEAIARSHLETQVHPRHVRVAVRLLKTSVISV***********************************************************TLVISDEYFQRVTQALVMRLRQHEESVIQEG*GLAGMRQKDLIKWYVEQQNE*****S***VKKEVSKLKAIIESLIRREGHLIVVD*****************RILAVAPNYVI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAFGGILVDEKAVRVENIFLEFLKSFRLDGNMGGESCYEAEIEAMRANESNTMFIDFSHVMRYNDLLQKAIADEYLRFEPYLKNACKRFVMEQNPNFISDDNPNKDINVAFFNIPFSKRLRELTTAEIGRLVSVTGVVTRTSEVRPELLQGTFKCLECGGVIKNVEQQFKYTEPTICANATCSNRTNWALLRQDSKFADWQRVRMQETSKEIPAGSLPRSLDVILRHDIVEQARAGDTVIFTGTVVVIPDILAMGSPGERAECRREASQRKSSAVGHDGVRGLRALGVRDLSYRLAFIANSVQIADGRRDTDIRNRKKDADEEDQHQFTTEEIDEIQRMRNAPDFFNKIVDSIGPTVFGHQDIKRAILLMLLGGVHKLTHEGINLRGDINVCIVGDPSCAKSQFLKYAAGIVPRSVYTSGKSSSAAGLTASVAKEPETGEFCIEAGALMLADNGICCIDEFDKMDIRDQVAIHEAMEQQTISITKAGIQATLNARTSILAAANPAGGRYDKSKPLKKHEDALAPAFTTAQLKRYIAYAKTLKPKLSLEARKLLVDSYVALRRGDTTPGSRVAYRMTVRQLEALIRLSEAIARSHLETQVHPRHVRVAVRLLKTSVISVESSEIDLSEFQEDNRDDGDGGDDGNDGNDQGDAQPRNRTPEPASGIAGNGASSANRQGKTLVISDEYFQRVTQALVMRLRQHEESVIQEGTGLAGMRQKDLIKWYVEQQNEKNTYSSxxxxxxxxxxxxxxxxxxxxxEGHLIVVDDGRQAAAEGEGRPSRDDRILAVAPNYVID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor Mcm6 Acts as component of the Mcm2-7 complex (Mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the Mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity Required for DNA replication and cell proliferation. Required for mitotic cycles, endocycles, and the special S phase associated with the amplification of chorion genes; has a role in origin unwinding or fork elongation at chorion loci.probableQ9V461
DNA replication licensing factor MCM6 Acts as component of the MCM2-7 complex (MCM complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the MCM2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.probableQ2KIZ8
Zygotic DNA replication licensing factor mcm6 Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. The existence of maternal and zygotic forms of mcm3 and mcm6 suggests that specific forms of mcm2-7 complexes may be used during different stages of development. May replace mmcm6 in the mcm2-7 complex.probableQ6P1V8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 15-260,272-309,324-619
View the alignment between query and template
View the model in PyMOL
Template: 2KLQ, chain A
Confidence level:very confident
Coverage over the Query: 676-794
View the alignment between query and template
View the model in PyMOL