BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 003815
(793 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2B78|A Chain A, A Putative Sam-Dependent Methyltransferase From
Streptococcus Mutans
pdb|3LDF|A Chain A, Crystal Structure Of Smu.776, A Putative Methyltransferase
Complexed With Sah
Length = 385
Score = 30.0 bits (66), Expect = 5.2, Method: Compositional matrix adjust.
Identities = 12/31 (38%), Positives = 17/31 (54%)
Query: 596 GYRDVHQDVDSFESELVDRLADFICYDWYKT 626
YR +QD DSF +D DF+ + WY +
Sbjct: 96 AYRLFNQDGDSFGGVTIDCYGDFVLFSWYNS 126
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.326 0.140 0.429
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,929,834
Number of Sequences: 62578
Number of extensions: 874304
Number of successful extensions: 1965
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1962
Number of HSP's gapped (non-prelim): 7
length of query: 793
length of database: 14,973,337
effective HSP length: 107
effective length of query: 686
effective length of database: 8,277,491
effective search space: 5678358826
effective search space used: 5678358826
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)