Citrus Sinensis ID: 003817

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790---

MDLEHGKCWDSSKKDSWKTILILAYQSLGVVYGDLGISPLYVYKSTFAEDIQHSNTNEEIFGALSFVFWTLTLVPLFKYVFIVLRADDNGEGGTFALYSSICRHAKVSLLPNRQAADEALSTYKLEQPPEKNSSRVKMYLEKHKFLHTALLILVLLGTCMVIGDGLLTPAISVFSAVSGLEFFMSKEHHQYAVIPITCFIIVCLFALQHYGTHRVGFLFAPVVLIWLLCISALGLYNIIHWNSHVYQALSPYYMFKFLKKTRKRGWMSLGGILLCITGSEAMFADLGHFSYAAIQIAFTFLVYPALILAYMGQAAYLSKHHETNYQISFFVSVPESVRWPVLVVAILASIVGSQAIISGTFSIINQSQSLGCFPRVKVVHTSDKIHGQIYIPEINWVLMILCIAVTIGFRDTKHIGNASGLAVMTVMLVTTCLTALVIILCWHKPPILALCFLLFFGSIELLYFSASLTKFREGAWLPILLALFLTTIMFVWHYATIKKYEFDLHNKVSLEWLLALGPSLGIARVPGIGLVFTDLTSGIPANFSRFVTNLPAFHRTLVFVCVKSVPVPHVPPAERYLVGRVGPAAHRSYRCIVRYGYRDVHQDVDSFESELVDRLADFICYDWYKTDRTNLYTDDAVTSRSNESTSDGRLAVIGTVSLSGAPAYEIEETLQPASVSGGFTSVESVTDVIEMEPVRAVQRRVRFAIDDQSDTDAQSEINLQSQQELEDLFAAQQAGTAFILGHSHVRAKQGSSLLKRLAINFGYNFLRRNCRGPDVALKVPPVSLLEVGMVYVV

ccccccccccccccccHHHHHHHHHHHHcEEEcccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccCECccccHHHHHcccccccccccccccCEHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHccccEEEEEccEEHHcccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccEECHHHHHHHHHHHHHEEEECcccHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccccEEEEEccccccccHHHHHHHHccccccEEEEEEEEEECccccccccccEEEEECccccccEEEEEEEECccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEEc

**************DSWKTILILAYQSLGVVYGDLGISPLYVYKSTFAEDIQHSNTNEEIFGALSFVFWTLTLVPLFKYVFIVLRADDNGEGGTFALYSSICRHAKVSLLPNRQAAD*******************KMYLEKHKFLHTALLILVLLGTCMVIGDGLLTPAISVFSAVSGLEFFMSKEHHQYAVIPITCFIIVCLFALQHYGTHRVGFLFAPVVLIWLLCISALGLYNIIHWNSHVYQALSPYYMFKFLKKTRKRGWMSLGGILLCITGSEAMFADLGHFSYAAIQIAFTFLVYPALILAYMGQAAYLSKHHETNYQISFFVSVPESVRWPVLVVAILASIVGSQAIISGTFSIINQSQSLGCFPRVKVVHTSDKIHGQIYIPEINWVLMILCIAVTIGFRDTKHIGNASGLAVMTVMLVTTCLTALVIILCWHKPPILALCFLLFFGSIELLYFSASLTKFREGAWLPILLALFLTTIMFVWHYATIKKYEFDLHNKVSLEWLLALGPSLGIARVPGIGLVFTDLTSGIPANFSRFVTNLPAFHRTLVFVCVKSVPVPHVPPAERYLVGRVGPAAHRSYRCIVRYGYRDVHQDVDSFESELVDRLADFICYDWYKTDRTN******************************************************************VQRRVRFAI*******************LEDLFAAQQAGTAFILGHSHVRAKQGSSLLKRLAINFGYNFLRRNCRGPDVALKVPPVSLLEVGMVYVV

xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Potassium transporter 2	Low-affinity potassium transporter. Could mediate the potassium-dependent cell expansion in growing tissues.	confident	O22881
Putative potassium transporter 8	High-affinity potassium transporter.	confident	Q8VXB5
Probable potassium transporter 9	High-affinity potassium transporter.	confident	Q7XIV8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DJK, chain A
Confidence level:probable
Coverage over the Query: 207-299
View the alignment between query and template
View the model in PyMOL