Citrus Sinensis ID: 003847

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-
MNSSCFNLYLWWRVLVVLVFICGVVVQSLGLNTDGVLLLSFKYSVLSDPLGVLGSWNYNDENPCSWNGVTCASPGEGNNDSRVIGLALPNSQLLGSIPADLGMIEFLQYLDLSNNSLNGSLSFSLFNASQLRNLDLSNNLISGHLPETMGSLHNLQLLNLSDNALAGKLPVSLTTLQSLTIVSLKNNYFSDGLPSKFNSVQVLDLSSNLINGSLPPDIGGYSLRYLNLSYNRLSGEIPPQFGEKIPVNATIDLSFNNLTGEIPESNVFMNQESSSFSGNLDLCGQPTKNPCPIPSSPFDLPNTTAPTSPPAIAAIPKSIDSTPATNPDDGSVSKPRQEGSQGLRPGTIIGIVIGDIAGIGILAVVFFYVYRLIKRKNVESTLKKEANSAKDTVSFSPSSSSSESRGFTRWSCLRKRGDGDEESDASVSDVEDNYHSGRKLSVDNQRQQDHVHERQNKKGTLVIVDGDKELELETLLKASAYILGASGSSIMYKAVLEDGTALAVRRIGENSVDRFRDFETQVRVIAKLVHPNLVRIRGFYWGVDEKLIIYDFVPNGSLANARYRKMGSSPCHLPWEARLKIAKGVARGLAFLHEKKHVHGNLKPRNVLLGNDMEPKIGDFGLERLVTGDTSSSKAGGSARNFGSKRSTASRDSFQDLGPGPSPSPSPSPSSLGGISPYHAPESLRSIKPNPKWDVYSFGVILLELLTGKVIVVDELGQGNGLLVEDKNRAIRLADAAIRADFEGKEEALLSCFKLGYSCASPLPQKRPSMKEALQALEKIPSSPSPYLYGH
ccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccccCCcccccccccccEEEEEccccccCECccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccEEEccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEcccccccHHHHHHccccEEccccccEEEEEEEccccEEEEEECccccccccHHHHHHHHHHccccccccccccEEECcccCEEEEEcccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccEEEEEcccHHHHccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccc
****CFNLYLWWRVLVVLVFICGVVVQSLGLNTDGVLLLSFKYSVLSDPLGVLGSWNYNDENPCSWNGVTCASPGEGNNDSRVIGLALPNSQLLGSIPADLGMIEFLQYLDLSNNSLNGSLSFSLFNASQLRNLDLSNNLISGHLPETMGSLHNLQLLNLSDNALAGKLPVSLTTLQSLTIVSLKNNYFSDGLPSKFNSVQVLDLSSNLINGSLPPDIGGYSLRYLNLSYNRLSGEIPPQFGEKIPVNATIDLSFNNLTGEIPESNVFMNQESSSFSGNLDLCGQPT**********************************************************GTIIGIVIGDIAGIGILAVVFFYVYRLIKRK******************************************************EDNYHSGRKLS******************TLVIVDGDKELELETLLKASAYILGASGSSIMYKAVLEDGTALAVRRIGENSVDRFRDFETQVRVIAKLVHPNLVRIRGFYWGVDEKLIIYDFVPNGSLANARYRKMGSSPCHLPWEARLKIAKGVARGLAFLHEKKHVHGNLKPRNVLLGNDMEPKIGDFGLERLVTGDTSS***************************************LGGISPYHAPESLRSIKPNPKWDVYSFGVILLELLTGKVIVVDELGQGNGLLVEDKNRAIRLADAAIRADFEGKEEALLSCFKLGYSCASPLPQKRPSMKEALQALE*************
xxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSSCFNLYLWWRVLVVLVFICGVVVQSLGLNTDGVLLLSFKYSVLSDPLGVLGSWNYNDENPCSWNGVTCASPGEGNNDSRVIGLALPNSQLLGSIPADLGMIEFLQYLDLSNNSLNGSLSFSLFNASQLRNLDLSNNLISGHLPETMGSLHNLQLLNLSDNALAGKLPVSLTTLQSLTIVSLKNNYFSDGLPSKFNSVQVLDLSSNLINGSLPPDIGGYSLRYLNLSYNRLSGEIPPQFGEKIPVNATIDLSFNNLTGEIPESNVFMNQESSSFSGNLDLCGQPTKNPCPIPSSPFDLPNTTAPTSPPAIAAIPKSIDSTPATNPDDGSVSKPRQEGSQGLRPGTIIGIVIGDIAGIGILAVVFFYVYRLIKRKNVESTLKKEANSAKDTVSFSPSSSSSESRGFTRWSCLRKRGDGDEESDASVSDVEDNYHSGRKLSVDNQRQQDHVHERQNKKGTLVIVDGDKELELETLLKASAYILGASGSSIMYKAVLEDGTALAVRRIGENSVDRFRDFETQVRVIAKLVHPNLVRIRGFYWGVDEKLIIYDFVPNGSLANARYRKMGSSPCHLPWEARLKIAKGVARGLAFLHEKKHVHGNLKPRNVLLGNDMEPKIGDFGLERLVTGDTSSSKAGGSARNFGSKRSTASRDSFQDLGPGPSPSPSPSPSSLGGISPYHAPESLRSIKPNPKWDVYSFGVILLELLTGKVIVVDELGQGNGLLVEDKNRAIRLADAAIRADFEGKEEALLSCFKLGYSCASPLPQKRPSMKEALQALEKIPSSPSPYLYGH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable LRR receptor-like serine/threonine-protein kinase At4g37250 probableC0LGS3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 30-281
View the alignment between query and template
View the model in PyMOL
Template: 3OZ6, chain A
Confidence level:very confident
Coverage over the Query: 490-643,654-655,672-776
View the alignment between query and template
View the model in PyMOL
Template: 2OIB, chain A
Confidence level:confident
Coverage over the Query: 487-649,678-781
View the alignment between query and template
View the model in PyMOL
Template: 2FO0, chain A
Confidence level:probable
Coverage over the Query: 454-645,678-726,740-780
View the alignment between query and template
View the model in PyMOL
Template: 3FXI, chain A
Confidence level:probable
Coverage over the Query: 86-265
View the alignment between query and template
View the model in PyMOL
Template: 2K1K, chain A
Confidence level:probable
Coverage over the Query: 340-348
View the alignment between query and template
View the model in PyMOL