Citrus Sinensis ID: 003862

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790

MMVDGVEDEEKWLAAGIAGLQQNAFYMHRALDSNNLRDALKYSAQMLSELRTSKLSPQKYYQLYMRAFDELRKLEMFFKEETRRGCSIIDLYELVQHAGNILPRLYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPVRGLFLRSYLSQISRDKLPDIGSEYEGDADTVNDAMEFVLQNFTEMNKLWVRMQHQGPAREKDKREKERSELRDLVGKNLHVLSQIEGVDLDTYKETVLPRVLEQVVNCKDEIAQCYLMDCIIQVFPDEYHLQTLEILLGAFPQLQPSVDIKTVLSRLMERLSNYAASSTEVLPEFLQVEAFSKLNNAIGKVIEAQADMPILGAVTLYSSLLTFTLHVHPDRLDYADQVLGACVKKLSGEGKLEDNRATKQIVALLSAPLDKYNDIVTVLKLSNYPSVMEYVDSETNKVMAMVIIQSIMKNNTQISTADKVGALFELIKGLIRDLDGAAHDQVDEDDFKEEQNSVARLIQMLQNDDTEEMFKIICTVRKHILTGGPKRLPFTVPPLVFSSLKLVRQLQGPEENPFGEEGSTTPKKVFQLLNQTIETLYGVPAPELALRLYLQCAEAANDSDLEPVAYEFFTQAYILYEEEISDSRAQVTAIHLIIGTLQRMHVFGVENRDTLTHKATGYSAKLLKKPDQCRAVYACSHLFWVDDQDNMKDGERVLLCLKRALRIANAAQQMSNATRGSTGSVTLFVEILNKYLYFFEKGNTQINAAAIQSLIELITAEMQSESNSPDPAADAFFASTLRYIQFQKQKGGAVGEKYEPIKV

cccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccc

****G*E**EKWLAAGIAGLQQNAFYMHRALDSNNLRDALKYSAQMLSELRTSKLSPQKYYQLYMRAFDELRKLEMFFKEETRRGCSIIDLYELVQHAGNILPRLYLLCTVGSVYIKSKEAPAKDVLKDLVEMCRGIQHPVRGLFLRSYLSQISRDKLPDIGSEYEGDADTVNDAMEFVLQNFTEMNKLWVR*******************LRDLVGKNLHVLSQIEGVDLDTYKETVLPRVLEQVVNCKDEIAQCYLMDCIIQVFPDEYHLQTLEILLGAFPQLQPSVDIKTVLSRLMERLSNYAASSTEVLPEFLQVEAFSKLNNAIGKVIEAQADMPILGAVTLYSSLLTFTLHVHPDRLDYADQVLGACVKKLSGEGKLEDNRATKQIVALLSAPLDKYNDIVTVLKLSNYPSVMEYVDSETNKVMAMVIIQSIMKNNTQISTADKVGALFELIKGLIRDLDGAA********FKEEQNSVARLIQMLQNDDTEEMFKIICTVRKHILTGGPKRLPFTVPPLVFSSLKLVRQLQGP*******EGSTTPKKVFQLLNQTIETLYGVPAPELALRLYLQCAEAANDSDLEPVAYEFFTQAYILYEEEISDSRAQVTAIHLIIGTLQRMHVFGVENRDTLTHKATGYSAKLLKKPDQCRAVYACSHLFWVDDQDNMKDGERVLLCLKRALRIANAAQQMSNATRGSTGSVTLFVEILNKYLYFFEKGNTQINAAAIQSLIELITA**************AFFASTLRYIQFQ*********KYEPIKV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 35A	Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. Also involved in the efficient sorting of seed storage proteins (By similarity). The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.	confident	Q7X659
Vacuolar protein sorting-associated protein 35	Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA).	probable	Q2HJG5
Vacuolar protein sorting-associated protein 35B	Plays a role in vesicular protein sorting. Component of the membrane-associated retromer complex which is essential in endosome-to-Golgi retrograde transport. Also involved in the efficient sorting of seed storage proteins globulin 12S and albumin 2S. The VPS29-VPS26-VPS35 subcomplex may be involved in recycling of specific cargos from endosome to the plasma membrane.	probable	F4I0P8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R17, chain C
Confidence level:very confident
Coverage over the Query: 477-774
View the alignment between query and template
View the model in PyMOL