Citrus Sinensis ID: 003865


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790
MAQVMNMAVDSLDRRRKDKSSAGDDNGNGNGNDNEDNIDNNNNNSAPQSSPPPPPPPARRRERDSRERRDDRDLDRPPPNRRGPDYYDRNRSPPPPMPRERDRDYKRRSTVSPPPPPLPYRDRRHSPPPRRSPPYKRSRRDDGGYEPRRGSPRGGFGPDRRFGYDYTGGYEREMGGRPGYGDERPHGRFAGRSSGGYQSGPSEWDSSRGGYGDASNTGSTQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWYFSSFTLFLLCTLRCSYYMCFVCRLKDKYHPTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNASSSNKLGQTSEPNSDDDVDNGGKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQAQALVRKLDSEKGITENILCGSDNDKMNREKSHGSTGPVIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETSEAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALDPFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNYMNDPDAPGGTPVMQQPMPKDRPLRRKLGPDNRLKDERGNRRDRDYRANGSDRYDRSDNAQASDFPSNDDVPEGANRDESMFDTFGGQGIRVAPPFPSDIPPPPVLMPVPGAGPLGPFVPAPPEVAMQMIRDQGGPPFEGGGRHGRPGPQISGPGPILLSPAFRQDPRRIRSYQDLDAPEDEVTVMDYRSL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHcccccHHHHHHHcccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***********************************************************************************************************************************************************************************************************************************YKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWYFSSFTLFLLCTLRCSYYMCFVCRLKDKYHPTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLG**********************************************************IQVDIEQAQALVRKLDS**GI***IL*****************GPVIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETSEAK*******************EWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALDPFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNYMNDP**********************************************************************************************************************************************************************SYQDLDAPEDEVTVMDYRSL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQVMNMAVDSLDRRRKDKSSAGDDNGNGNGNDNEDNIDNNNNNSAPQSSPPPPPPPARRRERDSRERRDDRDLDRPPPNRRGPDYYDRNRSPPPPMPRERDRDYKRRSTVSPPPPPLPYRDRRHSPPPRRSPPYKRSRRDDGGYEPRRGSPRGGFGPDRRFGYDYTGGYEREMGGRPGYGDERPHGRFAGRSSGGYQSGPSEWDSSRGGYGDASNTGSTQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWYFSSFTLFLLCTLRCSYYMCFVCRLKDKYHPTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNASSSNKLGQTSEPNSDDDVDNGGKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQAQALVRKLDSEKGITENILCGSDNDKMNREKSHGSTGPVIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETSEAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALDPFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNYMNDPDAPGGTPVMQQPMPKDRPLRRKLGPDNRLKDERGNRRDRDYRANGSDRYDRSDNAQASDFPSNDDVPEGANRDESMFDTFGGQGIRVAPPFPSDIPPPPVLMPVPGAGPLGPFVPAPPEVAMQMIRDQGGPPFEGGGRHGRPGPQISGPGPILLSPAFRQDPRRIRSYQDLDAPEDEVTVMDYRSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serrate RNA effector molecule Acts as a mediator between the cap-binding complex (CBC) and both the pre-mRNA splicing and primary microRNAs (miRNAs) processing machinery. Required for proper processing of primary miRNAs to miRNAs, thereby playing a role in RNA-mediated gene silencing (RNAi) by miRNAs. Does not participate in sense post-transcriptional gene silencing. Acts as a regulator of meristem activity and adaxial leaf fate via the miRNA gene-silencing pathway by regulating the expression of PHB and by limiting the competence of shoot tissue to respond to KNOX expression. Its function is however not limited to miRNA-mediated repression of leaf polarity genes, but rather acts as a general regulator of primary microRNAs processing. Also critical for the accumulation of the trans-acting small interfering RNA (ta-siRNA). Required for pre-mRNA splicing.probableQ9ZVD0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AX1, chain A
Confidence level:very confident
Coverage over the Query: 224-272,297-345,381-421,436-489,502-605
View the alignment between query and template
View the model in PyMOL
Template: 3PGW, chain S
Confidence level:probable
Coverage over the Query: 192-203
View the alignment between query and template
View the model in PyMOL