BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 003955
(784 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3UJH|A Chain A, Crystal Structure Of Substrate-Bound Glucose-6-Phosphate
Isomerase From Toxoplasma Gondii
pdb|3UJH|B Chain B, Crystal Structure Of Substrate-Bound Glucose-6-Phosphate
Isomerase From Toxoplasma Gondii
Length = 567
Score = 32.0 bits (71), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
Query: 198 AAQETTETVQRAIVPVA-SPPQSGEPASAD-KDELSAIKAGLRKVKIFTEYVST 249
+ ++ +T RA++ VA P+ EP D K+ L + A LR++++F+E V +
Sbjct: 87 SGEKINQTENRAVLHVALRMPEGSEPVHVDGKNVLDEVHAVLRRIRVFSEKVRS 140
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.133 0.395
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,583,935
Number of Sequences: 62578
Number of extensions: 711579
Number of successful extensions: 1399
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1397
Number of HSP's gapped (non-prelim): 4
length of query: 784
length of database: 14,973,337
effective HSP length: 107
effective length of query: 677
effective length of database: 8,277,491
effective search space: 5603861407
effective search space used: 5603861407
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)