BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 003955
         (784 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3UJH|A Chain A, Crystal Structure Of Substrate-Bound Glucose-6-Phosphate
           Isomerase From Toxoplasma Gondii
 pdb|3UJH|B Chain B, Crystal Structure Of Substrate-Bound Glucose-6-Phosphate
           Isomerase From Toxoplasma Gondii
          Length = 567

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 198 AAQETTETVQRAIVPVA-SPPQSGEPASAD-KDELSAIKAGLRKVKIFTEYVST 249
           + ++  +T  RA++ VA   P+  EP   D K+ L  + A LR++++F+E V +
Sbjct: 87  SGEKINQTENRAVLHVALRMPEGSEPVHVDGKNVLDEVHAVLRRIRVFSEKVRS 140


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.133    0.395 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 19,583,935
Number of Sequences: 62578
Number of extensions: 711579
Number of successful extensions: 1399
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 1397
Number of HSP's gapped (non-prelim): 4
length of query: 784
length of database: 14,973,337
effective HSP length: 107
effective length of query: 677
effective length of database: 8,277,491
effective search space: 5603861407
effective search space used: 5603861407
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)