Citrus Sinensis ID: 004021


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
MGNLISTSLPPDLFSRTLHRVGEQANYVWGLKKNLEGLKTEMRKLTRTRDDLVNKVEVEEQPRRTRRTNRVAGWLEDVQKLGTEFTELQQVRAQEMDRLCLGGLCSKNLVSSYNYGREVVELTDRVINLNKDGEKIAVVVEKAPDGAAIELPLEQTIVGQEKLLPRVWRCITDQQKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVQTFQDDIGKRIGFSEDKKWKEKSLQDKAVDISSILSPKKFRIDLTELGVPLQMLNAGFKIVLKTRSAGVCDQMDSKNLEVYSLAHDEAWKLFQEMIERSTLDSHTSIPELAETLARECGRLPLALKTVGRAMKSQKKVGDRERAIEKMRTSASTFSGMEENVFLRLKFSYDSLSMDKLRSCLLYCCLYPEDYKIPKRSLIDYWISEGFMADFDRGCEFINDLLHACLLEEEGDDHVKMHDMIREMSLWIAWTIEKEKKNFLVRAGVKLTEAPKVKEWEGAKRISLMANEIESLSEIPTLLSLRRNDSLTELPSRISSLVSLHHLDLSLTHIRGLPQELKALEKLRYLNLEYTHYLSIIPHQLISGFLKLEVLRLLECGSEGVTKEEGNVLCDDAEPLMRELLGLKRLNVLSWSFRSSLAVQKFFKYPKLDLTWLVFVQNLKELEIIVCTEMEEIICVDKLRDVSDISEIIGSEHNFFTQLESLGILYGPDLKSIYPNPLHFPKLKKIGVYGCPKLKKLPINSSSAKERRVVIEGLKEWWEELQWEDQATQNAFSSGVILGGD
ccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccECccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccHcHHHHHHHHHHcccccccEEEEECcccccHHHHHHHHHcccccccccccEEEEEEEcccHHHHHHHHccccccccccccHHHHHHHHHHHHcccCEEEEcccccccccccccccEEEEEEccHHHHHHcccccEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccHHHHHcccccccccHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccccccEEEcccHHHHHHHHHHHHccccccEEEEcccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccEEEccccccccccHHHHccccccccccccccccccccHHHHcccccccEEEcccccccccccccccccccccHHHHHHHccccccccEEEEEcccccccccccccccccHHHHHcccccccccccccccccccccccccccccccHHccccccccccccEEEECcccccccccccccccccccEEEECccccccccccccccccccEEEEcccccccccccccccccccccccccccccc
MGNLISTSLPPDLFSRTLHRVGEQANYVWGLKKNLEGLKTEMRKLTRTRDDLVNKVEVE******RRTNRVAGWLEDVQKLGTEFTELQQVRAQEMDRLCLGGLCSKNLVSSYNYGREVVELTDRVINLNKDGEKIAVVVEKA****AIELPLEQTIVGQEKLLPRVWRCITDQQKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVQTFQDDIGKRIGFSED********QDKAVDISSILSPKKFRIDLTELGVPLQMLNAGFKIVLKTRSAGVCDQMDSKNLEVYSLAHDEAWKLFQEMIERSTLDSHTSIPELAETLARECGRLPLALKTVGRAMKSQKKVGDRERAIEKMRTS*****GM*ENVFLRLKFSYDSLSMDKLRSCLLYCCLYPEDYKIPKRSLIDYWISEGFMADFDRGCEFINDLLHACLLEEEGDDHVKMHDMIREMSLWIAWTIEKEKKNFLVRAGVKLTEAPKVKEWEGAKRISLMANEIESLSEIPTLLSLRRNDSLTELPSRISSLVSLHHLDLSLTHIRGLPQELKALEKLRYLNLEYTHYLSIIPHQLISGFLKLEVLRLLECGSEGVTKEEGNVLCDDAEPLMRELLGLKRLNVLSWSFRSSLAVQKFFKYPKLDLTWLVFVQNLKELEIIVCTEMEEIICVDKLRDVSDISEIIGSEHNFFTQLESLGILYGPDLKSIYPNPLHFPKLKKIGVYGCPKLKKLPINSSSAKERRVVIEGLKEWWEELQWEDQATQNAFSSGVILGGD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNLISTSLPPDLFSRTLHRVGEQANYxxxxxxxxxxxxxxxxxxxxxxxxxxxxVEVEEQPRRTRRTNRVAGWLEDVQKLGTEFTELQQVRAQEMDRLCLGGLCSKNLVSSYNYGREVVELTDRVINLNKDGEKIAVVVEKAPDGAAIELPLEQTIVGQEKLLPRVWRCITDQQKNRGIIGLYGIGGVGKTTLLKQVNNNFCHQQHNFDVVIWAAVQTFQDDIGKRIGFSEDKKWKEKSLQDKAVDISSILSPKKFRIDLTELGVPLQMLNAGFKIVLKTRSAGVCDQMDSKNLEVYSLAHDEAWKLFQEMIERSTLDSHTSIPELAETLARECGRLPLALKTVGRAMKSQKKVGDRERAIEKMRTSASTFSGMEENVFLRLKFSYDSLSMDKLRSCLLYCCLYPEDYKIPKRSLIDYWISEGFMADFDRGCEFINDLLHACLLEEEGDDHVKMHDMIREMSLWIAWTIEKEKKNFLVRAGVKLTEAPKVKEWEGAKRISLMANEIESLSEIPTLLSLRRNDSLTELPSRISSLVSLHHLDLSLTHIRGLPQELKALEKLRYLNLEYTHYLSIIPHQLISGFLKLEVLRLLECGSEGVTKEEGNVLCDDAEPLMRELLGLKRLNVLSWSFRSSLAVQKFFKYPKLDLTWLVFVQNLKELEIIVCTEMEEIICVDKLRDVSDISEIIGSEHNFFTQLESLGILYGPDLKSIYPNPLHFPKLKKIGVYGCPKLKKLPINSSSAKERRVVIEGLKEWWEELQWEDQATQNAFSSGVILGGD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Disease resistance protein RPS5 Disease resistance (R) protein that specifically recognizes the avrPphB type III effector avirulence protein from Pseudomonas syringae. Also confers resistance against Hyaloperonospora parasitica (downy mildew). Resistance proteins guard the plant against pathogens that contain an appropriate avirulence protein via an indirect interaction with this avirulence protein. That triggers a defense system including the hypersensitive response, which restricts the pathogen growth. Requires PBS1 to trigger the defense reaction against avrPphB. Probably triggers the defense mechanism when PBS1 is cleaved by avrPphB, suggesting that it detects indirectly the protease activity of avrPphB, and possibly binds to the cleaved RPS5.probableO64973

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 491-673,690-752
View the alignment between query and template
View the model in PyMOL
Template: 2Z63, chain A
Confidence level:very confident
Coverage over the Query: 481-598,612-753
View the alignment between query and template
View the model in PyMOL
Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 154-470
View the alignment between query and template
View the model in PyMOL
Template: 3QFL, chain A
Confidence level:confident
Coverage over the Query: 8-98
View the alignment between query and template
View the model in PyMOL