BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 004092
         (774 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2DK7|A Chain A, Solution Structure Of Ww Domain In Transcription
           Elongation Regulator 1
          Length = 73

 Score = 33.9 bits (76), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 303 IPGSP-AKAWEADTNMDLYNDTVRVKMGFKPDDLV 336
           IPG+P    W  D  +  YN T R+ M  +PDDL+
Sbjct: 17  IPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLI 51


>pdb|3RDE|A Chain A, Crystal Structure Of The Catalytic Domain Of Porcine
           Leukocyte 12- Lipoxygenase
 pdb|3RDE|B Chain B, Crystal Structure Of The Catalytic Domain Of Porcine
           Leukocyte 12- Lipoxygenase
 pdb|3RDE|C Chain C, Crystal Structure Of The Catalytic Domain Of Porcine
           Leukocyte 12- Lipoxygenase
 pdb|3RDE|D Chain D, Crystal Structure Of The Catalytic Domain Of Porcine
           Leukocyte 12- Lipoxygenase
          Length = 573

 Score = 30.0 bits (66), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 523 MLLENVLKLPSEVAFPKSIKELSPKLKEEWQ-WHLFEA 559
           MLL + ++LP+ + FP  ++EL  +L++E Q   LFEA
Sbjct: 150 MLLRHSVELPARLKFPPGMEELQAQLEKELQGGTLFEA 187


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.138    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 21,882,560
Number of Sequences: 62578
Number of extensions: 895497
Number of successful extensions: 2006
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 15
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 1991
Number of HSP's gapped (non-prelim): 19
length of query: 774
length of database: 14,973,337
effective HSP length: 106
effective length of query: 668
effective length of database: 8,340,069
effective search space: 5571166092
effective search space used: 5571166092
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 55 (25.8 bits)