Citrus Sinensis ID: 004112

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770---

MKSELGVFDFKEEDELPELEAGKFLGKFKNPNNDDSPALKRELLECVTKETIVQIEGIGNVPCVNADAVDCAPSCNVDCAPSCNEQMCAPMKIGGEEGNDIRAPQMNSTSCEQSPNLEKDNCGFESCISELASRDLCTKGPLLGESQLCSGNLDPPSNNEPVDVNSDADGSMSEGSSSSPASDIAPNGVSLNGHMSDQWVDDSEVDDINMGVVVSPDYVFFRDKFCLGYLVVFSCTGIKIKDSNACGVQESFTFEKGIDDIVDIKFQWLQRFGSVEVKLHVILNDVAQDDNACGTSGIEELKFSFSDCNWSEQLEKITSLNAKYLALWSVDHDNPVDMDGVGQRRYFPNFDEPFEDVVYPEGDSDAVSISKRDIDLLQPDTFVNDTIIDFYIKYLKNQIQAEEKHRFHFFNSFFFRKLADLDKDPSSISDGKAAFLRVRKWTRKVDIFGKDYIFIPVNFNLHWSLIVICHPGDVASFKVEDLKRSEKVPCILHMDSIKGTHAGLKNLVQSYLCEEWKERHKDTSEDVSSKFLNFRFIPLELPQQENSFDCGLFLLHYLELFLAEAPVSFSPLKLKKLSSFLNVDWFPPGEASLKRSLIQKLISELLRNRSRVCLDEHQSSRFLENSVNEMRLEFLSEKCSAATAQHGNLSNSQAGQGVEITLLGATSGRNLQCANDSSLVLKELLEPGVTAGSLLAYQSFGEPSSYYHLNGAASAREHDVETAEEYGYLAAGSNGFQQITELTPQVGSISFPSRDFGTEAMEPRNLHARGAGR

ccccccccccccccccHHHHHHHccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccEEEEccccccccEEEEccccEEEccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEECHHHHccccccccccHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHcccccccccccHHHHHHHHHHHcccccccccccEEEEEccccccEEEEEEEccccccccccccccccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

***ELGV*DFK*****************************RELLECVTKETIVQIEGIGNVPCVNADAVDCAPSCNVDCAPSCNEQMCA********************************CGFESCISELASRDLCTKG*********************************************************QWVDDSEVDDINMGVVVSPDYVFFRDKFCLGYLVVFSCTGIKIKDSNACGVQESFTFEKGIDDIVDIKFQWLQRFGSVEVKLHVILNDVAQDDNACGTSGIEELKFSFSDCNWSEQLEKITSLNAKYLALWSV*************RRYFPNFDEPFEDVVYPEGDSDAVSISKRDIDLLQPDTFVNDTIIDFYIKYLKNQIQAEEKHRFHFFNSFFFRKLADLDKDPSSISDGKAAFLRVRKWTRKVDIFGKDYIFIPVNFNLHWSLIVICHPGDVASFKVEDLKRSEKVPCILHMDSIKGTHAGLKNLVQSYLCEEWKERHKDTSEDVSSKFLNFRFIPLELPQQENSFDCGLFLLHYLELFLAEAPVSFSPLKLKKLSSFLNVDWFPPGEASLKRSLIQKLISELLRNRS**********************************************GVEITLLGATSGRNLQCANDSSLVLKELLEPGVTAGSLLAYQSFGEPSSYYHLNGAAS****DVETAEEYGYLAAGSNGFQQITEL*******************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable ubiquitin-like-specific protease 2B	Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMOs to their mature forms and deconjugation of SUMO from targeted proteins.	probable	Q8L7S0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EAY, chain A
Confidence level:very confident
Coverage over the Query: 356-610
View the alignment between query and template
View the model in PyMOL