BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 004125
         (772 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3L84|A Chain A, High Resolution Crystal Structure Of Transketolase From
           Campylobacter Jejuni Subsp. Jejuni Nctc 11168
          Length = 632

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 665 TIWFH--YFSKDRYESAFVKYPLQEAMMKDTLERAREPNLNLKGYLR---NAYIHPVFKG 719
            I FH    SK R+ESA     L+EA  KD LE++ +  L L+  L    N   +P FKG
Sbjct: 277 NISFHIPQASKIRFESAVELGDLEEAKWKDKLEKSAKKEL-LERLLNPDFNKIAYPDFKG 335

Query: 720 ED 721
           +D
Sbjct: 336 KD 337


>pdb|3M7I|A Chain A, Crystal Structure Of Transketolase In Complex With
           Thiamine Diphosphate, Ribose-5-Phosphate(Pyranose Form)
           And Magnesium Ion
 pdb|3M34|A Chain A, Crystal Structure Of Transketolase In Complex With Thiamin
           D And Calcium Ion
 pdb|3M6L|A Chain A, Crystal Structure Of Transketolase In Complex With
           Thiamine Diphosphate, Ribose-5-Phosphate And Calcium Ion
          Length = 635

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 665 TIWFH--YFSKDRYESAFVKYPLQEAMMKDTLERAREPNLNLKGYLR---NAYIHPVFKG 719
            I FH    SK R+ESA     L+EA  KD LE++ +  L L+  L    N   +P FKG
Sbjct: 280 NISFHIPQASKIRFESAVELGDLEEAKWKDKLEKSAKKEL-LERLLNPDFNKIAYPDFKG 338

Query: 720 ED 721
           +D
Sbjct: 339 KD 340


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.139    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 20,759,106
Number of Sequences: 62578
Number of extensions: 799379
Number of successful extensions: 2683
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 2683
Number of HSP's gapped (non-prelim): 3
length of query: 772
length of database: 14,973,337
effective HSP length: 106
effective length of query: 666
effective length of database: 8,340,069
effective search space: 5554485954
effective search space used: 5554485954
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 55 (25.8 bits)