BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 004160
         (771 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NMD|A Chain A, Crystal Structure Of The Leucine Zipper Domain Of Cgmp
           Dependent Protein Kinase I Beta
 pdb|3NMD|B Chain B, Crystal Structure Of The Leucine Zipper Domain Of Cgmp
           Dependent Protein Kinase I Beta
 pdb|3NMD|C Chain C, Crystal Structure Of The Leucine Zipper Domain Of Cgmp
           Dependent Protein Kinase I Beta
 pdb|3NMD|D Chain D, Crystal Structure Of The Leucine Zipper Domain Of Cgmp
           Dependent Protein Kinase I Beta
 pdb|3NMD|E Chain E, Crystal Structure Of The Leucine Zipper Domain Of Cgmp
           Dependent Protein Kinase I Beta
          Length = 72

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 31/48 (64%)

Query: 371 SLKDAQVEVESERVKLRVTEARNKELERDLSMEKELVEELQNELNKEK 418
           SL+D Q  ++ +  +LR  +A   ELE +L  + EL++ LQNEL+K +
Sbjct: 20  SLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQXLQNELDKYR 67


>pdb|3TSB|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate
           Dehydrogenase From Bacillus Anthracis Str. Ames
 pdb|3TSB|B Chain B, Crystal Structure Of Inosine-5'-Monophosphate
           Dehydrogenase From Bacillus Anthracis Str. Ames
 pdb|3TSD|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate
           Dehydrogenase From Bacillus Anthracis Str. Ames
           Complexed With Xmp
 pdb|3TSD|B Chain B, Crystal Structure Of Inosine-5'-Monophosphate
           Dehydrogenase From Bacillus Anthracis Str. Ames
           Complexed With Xmp
          Length = 511

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 583 GLDKGNDNFRLQTKQLEIELKFARENLRMKEMEVLAAKRALTVKDEELKTVL 634
           G+D G +N   Q+  +  E KF +E L   ++ ++ AK  +  ++  +KTVL
Sbjct: 10  GVDLGTENLYFQSNAMW-ESKFVKEGLTFDDVLLVPAKSDVLPREVSVKTVL 60


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.127    0.323 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,313,534
Number of Sequences: 62578
Number of extensions: 561426
Number of successful extensions: 2348
Number of sequences better than 100.0: 153
Number of HSP's better than 100.0 without gapping: 28
Number of HSP's successfully gapped in prelim test: 125
Number of HSP's that attempted gapping in prelim test: 2099
Number of HSP's gapped (non-prelim): 316
length of query: 771
length of database: 14,973,337
effective HSP length: 106
effective length of query: 665
effective length of database: 8,340,069
effective search space: 5546145885
effective search space used: 5546145885
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 55 (25.8 bits)