BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 004183
(770 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q12529|SET6_YEAST Potential protein lysine methyltransferase SET6 OS=Saccharomyces
cerevisiae (strain ATCC 204508 / S288c) GN=SET6 PE=3
SV=1
Length = 373
Score = 35.4 bits (80), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 10/55 (18%)
Query: 286 FFQVASDGWKIRTCCGDGDDDNLVKFTVNLPNGTSVYQKALITGGSVSSKLAEDV 340
FFQV W R C +G N+P GT+V Q + TG S+S + ++V
Sbjct: 13 FFQVRQTKWGGRACFSNG----------NIPKGTTVLQVSNFTGTSISYEFRKEV 57
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.318 0.132 0.397
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 279,006,482
Number of Sequences: 539616
Number of extensions: 11624276
Number of successful extensions: 57948
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 29
Number of HSP's successfully gapped in prelim test: 44
Number of HSP's that attempted gapping in prelim test: 54710
Number of HSP's gapped (non-prelim): 2954
length of query: 770
length of database: 191,569,459
effective HSP length: 125
effective length of query: 645
effective length of database: 124,117,459
effective search space: 80055761055
effective search space used: 80055761055
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)