Citrus Sinensis ID: 004220


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------
MECKLQLLLWQEHLQWHCCSSSSRVIPSSYQCNKSEPSCFKLKQKKYLSFSNSTKSLRLRPLGALPENERNRKEQPMIIGIDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKKLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL
cccHHHHHHHHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHHHcccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHcccHHHHHccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHHHHHHHccccHHHHHHHHccccccccccEEEcccccHHHHHHHHHHccccccEEEEccccccccEEEEEEEHHHHHHHHHHccccc
**CKLQLLLWQEHLQWHCCSSSSRVIPSSYQ*******CFK***************************************IDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHAN****RQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYA********KLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MECKLQLLLWQEHLQWHCCSSSSRVIPSSYQCNKSEPSCFKLKQKKYLSFSNSTKSLRLRPLGALPENERNRKEQPMIIGIDGHEVGNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNRKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSKKLLVSEMCSADGETCCVPCTATPNMNLLSALILMDRYGVNQVPVVMEHIPGQRGQLVGLLDRESIILACRFCDFFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chloride channel protein CLC-e Voltage-gated chloride channel.probableQ8GX93

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QRD, chain G
Confidence level:very confident
Coverage over the Query: 616-761
View the alignment between query and template
View the model in PyMOL
Template: 1OTS, chain A
Confidence level:very confident
Coverage over the Query: 88-185,213-484,495-564
View the alignment between query and template
View the model in PyMOL
Template: 1KPK, chain A
Confidence level:probable
Coverage over the Query: 373-579
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3org, chain Avery confident Alignment | Template Structure