Citrus Sinensis ID: 004231


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760------
MFAKPLSFWIPKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYGQ
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccc
ccccccHHcccccccccccHHHHEEEHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccEHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEHHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEccc
mfakplsfwipkmpiinlqiHRSLSTLSATADAVIADKALTLLkrhpyqlnslsseftPEAAFNLLLKTQSDQTLTLKFLkwaqpqpfftpklkcltlHILTKFKLYKSAQTLAQNLAvdlprddgnfVFSCLKETyhlcdstsssaVIDLVVKSYSHLNMIDKAVNIVNLAKvhgfmpgvlSYNAILDSVIRSGRNNWVKFAEEVYNEmgksrvspnvytyNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMglkgiepnliSYNVIINGlckegrlkETKGILNEisrkglvpdevtYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHvrelrpnektYTTLINGFSQHGFLDEAYRLLNEMtkngfmpsIVTYNALIKghctggrveDAVGVLHGMarkglapdvvSYSTIISGFSRSQELDKAFDTKREMVekgvlpdtitySSLIHGLCEQRRITEACELFQEMLsrgmspdeftYTTLINAYctegdipqalrLHDEMiqkgflpdvVTYSVLINGLNKQARTMEAKKLLLKLfydesvpsdvIYNTlienctnieFQNVAALLKGFCMKGLMNEADRVFELMLQrnhmpneaVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMakdgllpnsgrstygq
mfakplsfwipKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYnemgksrvspNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGIlneisrkglvpdeVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIisgfsrsqelDKAFDTKREMVekgvlpdtitysSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEmakdgllpnsgrstygq
MFAKPLSFWIPKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYGQ
*****LSFWIPKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEM****************
*********I*************************ADKALTLLKR*********SEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYGQ
MFAKPLSFWIPKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYGQ
*FAKPLSFWIPKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYGQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAKPLSFWIPKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query766 2.2.26 [Sep-21-2011]
Q9FIX3747 Pentatricopeptide repeat- yes no 0.959 0.983 0.677 0.0
Q9LVQ5 1096 Pentatricopeptide repeat- no no 0.864 0.604 0.320 4e-96
Q9LFC5729 Pentatricopeptide repeat- no no 0.791 0.831 0.290 5e-88
Q0WVK7741 Pentatricopeptide repeat- no no 0.859 0.887 0.287 4e-87
Q9LFF1754 Pentatricopeptide repeat- no no 0.818 0.831 0.290 1e-85
Q9FJE6907 Putative pentatricopeptid no no 0.762 0.643 0.310 7e-83
Q9LSL9 915 Pentatricopeptide repeat- no no 0.668 0.559 0.317 3e-82
Q9LQ14629 Pentatricopeptide repeat- no no 0.699 0.852 0.304 1e-81
Q9CAN0630 Pentatricopeptide repeat- no no 0.714 0.868 0.298 3e-81
P0C894761 Putative pentatricopeptid no no 0.828 0.834 0.286 3e-80
>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1 Back     alignment and function desciption
 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/741 (67%), Positives = 615/741 (82%), Gaps = 6/741 (0%)

Query: 20  IHRSLSTL-SATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLK 78
           I RSLST  S+ +D+++ADKALT LKRHPYQL+ LS+ FTPEAA NLLLK+Q+DQ L LK
Sbjct: 8   IRRSLSTFASSPSDSLLADKALTFLKRHPYQLHHLSANFTPEAASNLLLKSQNDQALILK 67

Query: 79  FLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDD-GNFVFSCLKETY 137
           FL WA P  FFT + KC+TLHILTKFKLYK+AQ LA+++A     D+  + VF  L+ETY
Sbjct: 68  FLNWANPHQFFTLRCKCITLHILTKFKLYKTAQILAEDVAAKTLDDEYASLVFKSLQETY 127

Query: 138 HLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRN 197
            LC STSS  V DLVVKSYS L++IDKA++IV+LA+ HGFMPGVLSYNA+LD+ IRS RN
Sbjct: 128 DLCYSTSS--VFDLVVKSYSRLSLIDKALSIVHLAQAHGFMPGVLSYNAVLDATIRSKRN 185

Query: 198 NWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTY 257
             + FAE V+ EM +S+VSPNV+TYN+LIRGFC  G++++ L  F +ME   CL NVVTY
Sbjct: 186 --ISFAENVFKEMLESQVSPNVFTYNILIRGFCFAGNIDVALTLFDKMETKGCLPNVVTY 243

Query: 258 NTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISR 317
           NTLIDGYCKL +IDD FKLLR M LKG+EPNLISYNV+INGLC+EGR+KE   +L E++R
Sbjct: 244 NTLIDGYCKLRKIDDGFKLLRSMALKGLEPNLISYNVVINGLCREGRMKEVSFVLTEMNR 303

Query: 318 KGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNR 377
           +G   DEVTYNTL+ GYCKEGN HQALV+HAEM+R+GL+P+V+TYTSLI+SMCK+GN+NR
Sbjct: 304 RGYSLDEVTYNTLIKGYCKEGNFHQALVMHAEMLRHGLTPSVITYTSLIHSMCKAGNMNR 363

Query: 378 AMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIK 437
           AMEF DQM VR L PNE+TYTTL++GFSQ G+++EAYR+L EM  NGF PS+VTYNALI 
Sbjct: 364 AMEFLDQMRVRGLCPNERTYTTLVDGFSQKGYMNEAYRVLREMNDNGFSPSVVTYNALIN 423

Query: 438 GHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLP 497
           GHC  G++EDA+ VL  M  KGL+PDVVSYST++SGF RS ++D+A   KREMVEKG+ P
Sbjct: 424 GHCVTGKMEDAIAVLEDMKEKGLSPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKP 483

Query: 498 DTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLH 557
           DTITYSSLI G CEQRR  EAC+L++EML  G+ PDEFTYT LINAYC EGD+ +AL+LH
Sbjct: 484 DTITYSSLIQGFCEQRRTKEACDLYEEMLRVGLPPDEFTYTALINAYCMEGDLEKALQLH 543

Query: 558 DEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNI 617
           +EM++KG LPDVVTYSVLINGLNKQ+RT EAK+LLLKLFY+ESVPSDV Y+TLIENC+NI
Sbjct: 544 NEMVEKGVLPDVVTYSVLINGLNKQSRTREAKRLLLKLFYEESVPSDVTYHTLIENCSNI 603

Query: 618 EFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLY 677
           EF++V +L+KGFCMKG+M EAD+VFE ML +NH P+   Y+I+IHGH + G+++KAY LY
Sbjct: 604 EFKSVVSLIKGFCMKGMMTEADQVFESMLGKNHKPDGTAYNIMIHGHCRAGDIRKAYTLY 663

Query: 678 KKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKE 737
           K+MV+SGF+ HTVT+I LVKALH  G   EL+ VI ++LRSC LS+AE AKVLVEINH+E
Sbjct: 664 KEMVKSGFLLHTVTVIALVKALHKEGKVNELNSVIVHVLRSCELSEAEQAKVLVEINHRE 723

Query: 738 GNMDAVLNVLTEMAKDGLLPN 758
           GNMD VL+VL EMAKDG LPN
Sbjct: 724 GNMDVVLDVLAEMAKDGFLPN 744





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=2 SV=2 Back     alignment and function description
>sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 Back     alignment and function description
>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein At1g05670, mitochondrial OS=Arabidopsis thaliana GN=At1g05670 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containing protein At2g02150 OS=Arabidopsis thaliana GN=At2g02150 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
359475386762 PREDICTED: pentatricopeptide repeat-cont 0.988 0.993 0.699 0.0
224103543751 predicted protein [Populus trichocarpa] 0.971 0.990 0.695 0.0
15242446747 pentatricopeptide repeat-containing prot 0.959 0.983 0.677 0.0
297805766747 EMB2745 [Arabidopsis lyrata subsp. lyrat 0.963 0.987 0.673 0.0
449495714749 PREDICTED: LOW QUALITY PROTEIN: pentatri 0.964 0.986 0.654 0.0
449438681749 PREDICTED: pentatricopeptide repeat-cont 0.964 0.986 0.654 0.0
356577033757 PREDICTED: pentatricopeptide repeat-cont 0.950 0.961 0.634 0.0
255561697533 pentatricopeptide repeat-containing prot 0.644 0.926 0.747 0.0
297741319851 unnamed protein product [Vitis vinifera] 0.677 0.609 0.741 0.0
218197600694 hypothetical protein OsI_21710 [Oryza sa 0.792 0.874 0.490 1e-174
>gi|359475386|ref|XP_003631674.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1114 bits (2882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/761 (69%), Positives = 634/761 (83%), Gaps = 4/761 (0%)

Query: 5   PLSFWIPKMPIINLQIHRSLSTLSATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFN 64
           P S+  P +P +     R  S+LS+T+ A++ DKA+TLLK HP+ L+SLSS FTP++A  
Sbjct: 4   PKSYHRPNLPELVSSKAR-FSSLSSTSHALLVDKAITLLKFHPHHLDSLSSRFTPQSASY 62

Query: 65  LLLKTQSDQTLTLKFLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRD 124
            LLK+Q DQTLTLKFL WA+  PFF    KCL+LHILT+FKLYK+AQTLAQ LA+     
Sbjct: 63  FLLKSQFDQTLTLKFLTWARNHPFFDSHCKCLSLHILTRFKLYKTAQTLAQELALSASDP 122

Query: 125 DGNFVFSCLKETYHLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSY 184
            G+ +F CLK++YH+ +S  SSAV DL+VKSYSHLNMID+AVN +NLAK  GFMPGVLSY
Sbjct: 123 SGSSIFQCLKDSYHVYNS--SSAVFDLMVKSYSHLNMIDQAVNTINLAKSSGFMPGVLSY 180

Query: 185 NAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSE 244
           N++LD+++RS R +    AEEVY EM +SRVSPNVYTYN+LIRGFC VG+L+ GL  F E
Sbjct: 181 NSVLDAIVRS-RGSVKLSAEEVYREMIRSRVSPNVYTYNILIRGFCSVGELQKGLGCFGE 239

Query: 245 MEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGR 304
           ME+N CL NVVTYNTLID YCK+GRID+AF LL+ M  KG++PNLISYNVIINGLC+EG 
Sbjct: 240 MERNGCLPNVVTYNTLIDAYCKMGRIDEAFGLLKSMSSKGMQPNLISYNVIINGLCREGS 299

Query: 305 LKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTS 364
           +KE   IL E+  KG  PDEVTYNTLLNGYCKEGN HQALV+HAEMVRNG+SP+VVTYT+
Sbjct: 300 MKEAWEILEEMGYKGFTPDEVTYNTLLNGYCKEGNFHQALVIHAEMVRNGVSPSVVTYTA 359

Query: 365 LINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNG 424
           LINSMCK+ NLNRAMEFFDQM +R LRPNE+TYTTLI+GFS+ G L+EAYR+LNEMT++G
Sbjct: 360 LINSMCKARNLNRAMEFFDQMRIRGLRPNERTYTTLIDGFSRQGLLNEAYRILNEMTESG 419

Query: 425 FMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAF 484
           F PS+VTYNA I GHC   R+E+A+GV+  M  KGLAPDVVSYSTIISGF R  ELD+AF
Sbjct: 420 FSPSVVTYNAFIHGHCVLERMEEALGVVQEMVEKGLAPDVVSYSTIISGFCRKGELDRAF 479

Query: 485 DTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAY 544
             K+EMVEKGV PD +TYSSLI GLCE RR+TEAC+L QEML  G+ PDEFTYTTLINAY
Sbjct: 480 QMKQEMVEKGVSPDAVTYSSLIQGLCEMRRLTEACDLSQEMLDMGLPPDEFTYTTLINAY 539

Query: 545 CTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSD 604
           C EGD+ +AL LHDEMI KGFLPD VTYSVLINGLNKQART EAK+LL KL Y+ESVPSD
Sbjct: 540 CVEGDLNKALHLHDEMIHKGFLPDAVTYSVLINGLNKQARTREAKRLLFKLIYEESVPSD 599

Query: 605 VIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGH 664
           V Y+TLIENC+NIEF++V AL+KGFCMKGLM+EADRVFE M++RNH P EAVY++IIHGH
Sbjct: 600 VTYDTLIENCSNIEFKSVVALIKGFCMKGLMHEADRVFESMVERNHKPGEAVYNVIIHGH 659

Query: 665 SKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDA 724
            + GN+ KA++LYK+M+ SGFVPHTVT+I L+KAL   GMNEE+S+VI + LRSCRL++A
Sbjct: 660 CRGGNLPKAFNLYKEMIHSGFVPHTVTVITLIKALFKEGMNEEMSEVIGDTLRSCRLNEA 719

Query: 725 ELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYG 765
           ELAKVLVEINHKEGNM+AVLNVLT+MAKDGLLPNSG++ Y 
Sbjct: 720 ELAKVLVEINHKEGNMEAVLNVLTDMAKDGLLPNSGKTAYA 760




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224103543|ref|XP_002313097.1| predicted protein [Populus trichocarpa] gi|222849505|gb|EEE87052.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15242446|ref|NP_198787.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75170916|sp|Q9FIX3.1|PP407_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g39710; AltName: Full=Protein EMBRYO DEFECTIVE 2745 gi|10177971|dbj|BAB11377.1| unnamed protein product [Arabidopsis thaliana] gi|332007083|gb|AED94466.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297805766|ref|XP_002870767.1| EMB2745 [Arabidopsis lyrata subsp. lyrata] gi|297316603|gb|EFH47026.1| EMB2745 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449495714|ref|XP_004159923.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g39710-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449438681|ref|XP_004137116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356577033|ref|XP_003556634.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Glycine max] Back     alignment and taxonomy information
>gi|255561697|ref|XP_002521858.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538896|gb|EEF40494.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297741319|emb|CBI32450.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|218197600|gb|EEC80027.1| hypothetical protein OsI_21710 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query766
TAIR|locus:2164910747 EMB2745 "EMBRYO DEFECTIVE 2745 0.959 0.983 0.677 6e-277
TAIR|locus:2150024729 AT5G01110 [Arabidopsis thalian 0.904 0.950 0.279 2.9e-80
TAIR|locus:2168078 907 AT5G59900 "AT5G59900" [Arabido 0.802 0.678 0.316 2.6e-79
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.836 0.850 0.296 1.6e-77
TAIR|locus:2139732566 AT4G11690 [Arabidopsis thalian 0.667 0.902 0.346 1.6e-77
TAIR|locus:2016427 904 AT1G19290 [Arabidopsis thalian 0.742 0.629 0.295 7.1e-77
TAIR|locus:2053552627 AT2G15630 "AT2G15630" [Arabido 0.761 0.929 0.303 2.4e-76
TAIR|locus:2019085763 AT1G74580 "AT1G74580" [Arabido 0.763 0.766 0.291 3.9e-76
TAIR|locus:2015213629 AT1G63150 [Arabidopsis thalian 0.607 0.739 0.331 1.3e-66
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.746 0.907 0.3 2.7e-75
TAIR|locus:2164910 EMB2745 "EMBRYO DEFECTIVE 2745" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2662 (942.1 bits), Expect = 6.0e-277, P = 6.0e-277
 Identities = 502/741 (67%), Positives = 615/741 (82%)

Query:    20 IHRSLSTL-SATADAVIADKALTLLKRHPYQLNSLSSEFTPEAAFNLLLKTQSDQTLTLK 78
             I RSLST  S+ +D+++ADKALT LKRHPYQL+ LS+ FTPEAA NLLLK+Q+DQ L LK
Sbjct:     8 IRRSLSTFASSPSDSLLADKALTFLKRHPYQLHHLSANFTPEAASNLLLKSQNDQALILK 67

Query:    79 FLKWAQPQPFFTPKLKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDD-GNFVFSCLKETY 137
             FL WA P  FFT + KC+TLHILTKFKLYK+AQ LA+++A     D+  + VF  L+ETY
Sbjct:    68 FLNWANPHQFFTLRCKCITLHILTKFKLYKTAQILAEDVAAKTLDDEYASLVFKSLQETY 127

Query:   138 HLCDSTSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRN 197
              LC STSS  V DLVVKSYS L++IDKA++IV+LA+ HGFMPGVLSYNA+LD+ IRS RN
Sbjct:   128 DLCYSTSS--VFDLVVKSYSRLSLIDKALSIVHLAQAHGFMPGVLSYNAVLDATIRSKRN 185

Query:   198 NWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTY 257
               + FAE V+ EM +S+VSPNV+TYN+LIRGFC  G++++ L  F +ME   CL NVVTY
Sbjct:   186 --ISFAENVFKEMLESQVSPNVFTYNILIRGFCFAGNIDVALTLFDKMETKGCLPNVVTY 243

Query:   258 NTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISR 317
             NTLIDGYCKL +IDD FKLLR M LKG+EPNLISYNV+INGLC+EGR+KE   +L E++R
Sbjct:   244 NTLIDGYCKLRKIDDGFKLLRSMALKGLEPNLISYNVVINGLCREGRMKEVSFVLTEMNR 303

Query:   318 KGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNR 377
             +G   DEVTYNTL+ GYCKEGN HQALV+HAEM+R+GL+P+V+TYTSLI+SMCK+GN+NR
Sbjct:   304 RGYSLDEVTYNTLIKGYCKEGNFHQALVMHAEMLRHGLTPSVITYTSLIHSMCKAGNMNR 363

Query:   378 AMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIK 437
             AMEF DQM VR L PNE+TYTTL++GFSQ G+++EAYR+L EM  NGF PS+VTYNALI 
Sbjct:   364 AMEFLDQMRVRGLCPNERTYTTLVDGFSQKGYMNEAYRVLREMNDNGFSPSVVTYNALIN 423

Query:   438 GHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLP 497
             GHC  G++EDA+ VL  M  KGL+PDVVSYST++SGF RS ++D+A   KREMVEKG+ P
Sbjct:   424 GHCVTGKMEDAIAVLEDMKEKGLSPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKP 483

Query:   498 DTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLH 557
             DTITYSSLI G CEQRR  EAC+L++EML  G+ PDEFTYT LINAYC EGD+ +AL+LH
Sbjct:   484 DTITYSSLIQGFCEQRRTKEACDLYEEMLRVGLPPDEFTYTALINAYCMEGDLEKALQLH 543

Query:   558 DEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNI 617
             +EM++KG LPDVVTYSVLINGLNKQ+RT EAK+LLLKLFY+ESVPSDV Y+TLIENC+NI
Sbjct:   544 NEMVEKGVLPDVVTYSVLINGLNKQSRTREAKRLLLKLFYEESVPSDVTYHTLIENCSNI 603

Query:   618 EFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGNVQKAYDLY 677
             EF++V +L+KGFCMKG+M EAD+VFE ML +NH P+   Y+I+IHGH + G+++KAY LY
Sbjct:   604 EFKSVVSLIKGFCMKGMMTEADQVFESMLGKNHKPDGTAYNIMIHGHCRAGDIRKAYTLY 663

Query:   678 KKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKE 737
             K+MV+SGF+ HTVT+I LVKALH  G   EL+ VI ++LRSC LS+AE AKVLVEINH+E
Sbjct:   664 KEMVKSGFLLHTVTVIALVKALHKEGKVNELNSVIVHVLRSCELSEAEQAKVLVEINHRE 723

Query:   738 GNMDAVLNVLTEMAKDGLLPN 758
             GNMD VL+VL EMAKDG LPN
Sbjct:   724 GNMDVVLDVLAEMAKDGFLPN 744


GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
TAIR|locus:2150024 AT5G01110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168078 AT5G59900 "AT5G59900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139732 AT4G11690 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016427 AT1G19290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053552 AT2G15630 "AT2G15630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019085 AT1G74580 "AT1G74580" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015213 AT1G63150 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FIX3PP407_ARATHNo assigned EC number0.67740.95950.9839yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00036545001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (762 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 9e-43
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-37
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 7e-33
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 5e-32
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-32
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-27
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 5e-24
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 6e-22
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-21
pfam1304150 pfam13041, PPR_2, PPR repeat family 6e-21
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-19
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-19
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-18
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-17
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-16
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-16
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-16
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-15
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-14
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-14
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-13
pfam1285434 pfam12854, PPR_1, PPR repeat 3e-13
pfam1285434 pfam12854, PPR_1, PPR repeat 1e-12
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-11
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-09
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-09
PLN03081 697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-09
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 6e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 4e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 7e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 8e-08
pfam0153531 pfam01535, PPR, PPR repeat 8e-08
pfam1285434 pfam12854, PPR_1, PPR repeat 9e-08
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-07
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-06
pfam0153531 pfam01535, PPR, PPR repeat 1e-06
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-06
pfam0153531 pfam01535, PPR, PPR repeat 2e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-06
pfam1285434 pfam12854, PPR_1, PPR repeat 6e-06
pfam0153531 pfam01535, PPR, PPR repeat 8e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-05
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 3e-05
pfam0153531 pfam01535, PPR, PPR repeat 4e-05
pfam0153531 pfam01535, PPR, PPR repeat 6e-05
pfam1285434 pfam12854, PPR_1, PPR repeat 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 8e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.001
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.001
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 0.002
pfam1285434 pfam12854, PPR_1, PPR repeat 0.003
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score =  167 bits (424), Expect = 9e-43
 Identities = 96/370 (25%), Positives = 183/370 (49%), Gaps = 7/370 (1%)

Query: 217 PNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKL 276
           P + T+N+L+       D++  LR    +++    A+   Y TLI    K G++D  F++
Sbjct: 435 PTLSTFNMLMSVCASSQDIDGALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEV 494

Query: 277 LRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCK 336
             +M   G+E N+ ++  +I+G  + G++ +  G    +  K + PD V +N L++   +
Sbjct: 495 FHEMVNAGVEANVHTFGALIDGCARAGQVAKAFGAYGIMRSKNVKPDRVVFNALISACGQ 554

Query: 337 EGNLHQALVLHAEMVRNG--LSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNE 394
            G + +A  + AEM      + P+ +T  +L+ +   +G ++RA E +  +H   ++   
Sbjct: 555 SGAVDRAFDVLAEMKAETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTP 614

Query: 395 KTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIK--GHCTGGRVEDAVGVL 452
           + YT  +N  SQ G  D A  + ++M K G  P  V ++AL+   GH   G ++ A  +L
Sbjct: 615 EVYTIAVNSCSQKGDWDFALSIYDDMKKKGVKPDEVFFSALVDVAGH--AGDLDKAFEIL 672

Query: 453 HGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQ 512
               ++G+    VSYS+++   S ++   KA +   ++    + P   T ++LI  LCE 
Sbjct: 673 QDARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEG 732

Query: 513 RRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTY 572
            ++ +A E+  EM   G+ P+  TY+ L+ A   + D    L L  +  + G  P++V  
Sbjct: 733 NQLPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMC 792

Query: 573 SVLINGLNKQ 582
             +  GL  +
Sbjct: 793 RCIT-GLCLR 801


Length = 1060

>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 766
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03218 1060 maturation of RBCL 1; Provisional 100.0
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.98
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.92
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.91
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.85
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.85
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.84
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.84
PRK14574 822 hmsH outer membrane protein; Provisional 99.81
KOG2076895 consensus RNA polymerase III transcription factor 99.81
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
KOG2076895 consensus RNA polymerase III transcription factor 99.76
KOG2003840 consensus TPR repeat-containing protein [General f 99.74
KOG1915677 consensus Cell cycle control protein (crooked neck 99.74
KOG2003 840 consensus TPR repeat-containing protein [General f 99.72
KOG1915677 consensus Cell cycle control protein (crooked neck 99.69
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.61
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.61
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.61
KOG0547606 consensus Translocase of outer mitochondrial membr 99.6
KOG0547606 consensus Translocase of outer mitochondrial membr 99.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.58
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.58
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.57
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.57
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.55
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.55
KOG1126638 consensus DNA-binding cell division cycle control 99.54
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.54
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.54
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.53
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.53
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.53
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.52
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.51
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.5
KOG1126638 consensus DNA-binding cell division cycle control 99.47
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.46
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.46
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.45
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.44
KOG1129478 consensus TPR repeat-containing protein [General f 99.42
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.42
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.41
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.33
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.33
PRK12370553 invasion protein regulator; Provisional 99.31
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.31
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.3
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.3
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.29
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.28
PF1304150 PPR_2: PPR repeat family 99.28
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.28
PF1304150 PPR_2: PPR repeat family 99.27
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.26
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.26
PRK12370553 invasion protein regulator; Provisional 99.25
PRK11189296 lipoprotein NlpI; Provisional 99.21
KOG2376652 consensus Signal recognition particle, subunit Srp 99.21
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.18
KOG1129478 consensus TPR repeat-containing protein [General f 99.16
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.12
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.12
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.11
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.1
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.08
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.07
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.06
PRK11189296 lipoprotein NlpI; Provisional 99.04
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.99
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.99
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.98
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.98
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.97
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.93
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.93
PRK04841903 transcriptional regulator MalT; Provisional 98.89
PRK04841 903 transcriptional regulator MalT; Provisional 98.88
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.87
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.87
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.84
KOG1125579 consensus TPR repeat-containing protein [General f 98.82
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.82
KOG1125579 consensus TPR repeat-containing protein [General f 98.79
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.74
PF1285434 PPR_1: PPR repeat 98.73
PF1285434 PPR_1: PPR repeat 98.7
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.68
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.68
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.66
PRK10370198 formate-dependent nitrite reductase complex subuni 98.63
PLN02789320 farnesyltranstransferase 98.61
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.61
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.59
PLN02789320 farnesyltranstransferase 98.5
KOG1128777 consensus Uncharacterized conserved protein, conta 98.5
PRK15359144 type III secretion system chaperone protein SscB; 98.49
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.49
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.47
PRK15359144 type III secretion system chaperone protein SscB; 98.46
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.44
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.43
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.42
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.4
PRK10370198 formate-dependent nitrite reductase complex subuni 98.39
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.35
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.3
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.3
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.26
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.25
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.23
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.22
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.2
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.2
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.11
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.08
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 98.04
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.98
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.97
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.95
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.93
KOG0553304 consensus TPR repeat-containing protein [General f 97.92
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 97.91
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.9
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.9
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.82
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.8
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.79
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.75
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.74
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.7
COG3898 531 Uncharacterized membrane-bound protein [Function u 97.69
KOG20411189 consensus WD40 repeat protein [General function pr 97.67
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.66
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.66
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.65
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.63
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.62
KOG20411189 consensus WD40 repeat protein [General function pr 97.61
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.6
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.59
PF12688120 TPR_5: Tetratrico peptide repeat 97.59
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.58
COG4700251 Uncharacterized protein conserved in bacteria cont 97.58
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.58
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.57
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.56
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.56
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.54
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.52
COG4700251 Uncharacterized protein conserved in bacteria cont 97.5
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.49
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.47
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.47
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.47
KOG0553 304 consensus TPR repeat-containing protein [General f 97.44
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.38
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.36
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.36
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.35
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.35
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.35
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.33
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.32
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.25
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.22
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.21
PRK10803263 tol-pal system protein YbgF; Provisional 97.2
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.16
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.14
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.13
PF12688120 TPR_5: Tetratrico peptide repeat 97.1
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.1
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.09
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.03
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.02
PRK15331165 chaperone protein SicA; Provisional 96.98
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.91
COG3898531 Uncharacterized membrane-bound protein [Function u 96.85
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.8
PRK10803263 tol-pal system protein YbgF; Provisional 96.76
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.75
PF1337173 TPR_9: Tetratricopeptide repeat 96.74
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.68
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.68
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.62
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.62
PRK11906458 transcriptional regulator; Provisional 96.58
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.57
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.55
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.51
PF1337173 TPR_9: Tetratricopeptide repeat 96.45
PRK15331165 chaperone protein SicA; Provisional 96.42
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.38
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.38
COG0457291 NrfG FOG: TPR repeat [General function prediction 96.32
PF13281374 DUF4071: Domain of unknown function (DUF4071) 96.3
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 96.28
KOG2610 491 consensus Uncharacterized conserved protein [Funct 96.18
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.08
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.04
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.02
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 96.0
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.97
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.87
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.86
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.83
KOG4555175 consensus TPR repeat-containing protein [Function 95.82
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.71
PRK11906458 transcriptional regulator; Provisional 95.71
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.7
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.63
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.6
KOG4555175 consensus TPR repeat-containing protein [Function 95.57
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.54
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.51
PF1342844 TPR_14: Tetratricopeptide repeat 95.49
KOG1585308 consensus Protein required for fusion of vesicles 95.4
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.39
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.36
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.33
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.29
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.28
KOG1585308 consensus Protein required for fusion of vesicles 95.23
KOG1258577 consensus mRNA processing protein [RNA processing 95.21
smart00299140 CLH Clathrin heavy chain repeat homology. 95.2
COG4105254 ComL DNA uptake lipoprotein [General function pred 95.14
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.02
PF1343134 TPR_17: Tetratricopeptide repeat 95.0
PF13512142 TPR_18: Tetratricopeptide repeat 94.84
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.78
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.64
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.63
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 94.58
KOG2796366 consensus Uncharacterized conserved protein [Funct 94.52
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.44
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.42
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 94.41
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.37
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.23
COG2976207 Uncharacterized protein conserved in bacteria [Fun 94.19
KOG3941406 consensus Intermediate in Toll signal transduction 94.17
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.1
smart00299140 CLH Clathrin heavy chain repeat homology. 94.04
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.03
KOG1550552 consensus Extracellular protein SEL-1 and related 93.88
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 93.69
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.64
PF13512142 TPR_18: Tetratricopeptide repeat 93.46
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.41
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 93.31
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.31
KOG1586288 consensus Protein required for fusion of vesicles 93.04
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.02
KOG1550552 consensus Extracellular protein SEL-1 and related 92.9
KOG3941406 consensus Intermediate in Toll signal transduction 92.8
KOG4234271 consensus TPR repeat-containing protein [General f 92.54
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.29
KOG1258577 consensus mRNA processing protein [RNA processing 92.11
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.91
PF1342844 TPR_14: Tetratricopeptide repeat 91.88
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 91.81
PF02259 352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.78
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 91.68
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.3
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 91.2
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.12
COG2976207 Uncharacterized protein conserved in bacteria [Fun 91.06
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 91.01
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 90.98
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.78
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 90.7
COG3629280 DnrI DNA-binding transcriptional activator of the 90.53
PF1343134 TPR_17: Tetratricopeptide repeat 90.21
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 90.1
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 90.06
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 90.0
KOG4234271 consensus TPR repeat-containing protein [General f 89.8
COG3629280 DnrI DNA-binding transcriptional activator of the 89.7
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.34
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 89.1
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.89
COG3947361 Response regulator containing CheY-like receiver a 88.81
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.45
PF09986214 DUF2225: Uncharacterized protein conserved in bact 87.51
KOG4648 536 consensus Uncharacterized conserved protein, conta 87.31
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 86.8
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 86.5
PRK09687280 putative lyase; Provisional 86.44
KOG4570418 consensus Uncharacterized conserved protein [Funct 86.31
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.12
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 85.9
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 85.89
KOG2471 696 consensus TPR repeat-containing protein [General f 85.85
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.73
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 85.71
KOG2062 929 consensus 26S proteasome regulatory complex, subun 85.68
KOG4648 536 consensus Uncharacterized conserved protein, conta 85.66
KOG4570 418 consensus Uncharacterized conserved protein [Funct 85.18
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.78
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 84.58
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 83.97
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 82.63
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.23
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.6
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 81.6
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 81.07
KOG2297412 consensus Predicted translation factor, contains W 80.99
PRK09687280 putative lyase; Provisional 80.97
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 80.64
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 80.21
PF07575566 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR0 80.2
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.13
COG5159421 RPN6 26S proteasome regulatory complex component [ 80.02
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-81  Score=730.81  Aligned_cols=655  Identities=19%  Similarity=0.277  Sum_probs=598.8

Q ss_pred             cCCChhHHHHHHHhhcCCCCCCCc--hhHHHHHHHHhCCCchHHHHHHHHHHHhCCCCChhhHHHHHHHhcccCCC----
Q 004231           69 TQSDQTLTLKFLKWAQPQPFFTPK--LKCLTLHILTKFKLYKSAQTLAQNLAVDLPRDDGNFVFSCLKETYHLCDS----  142 (766)
Q Consensus        69 ~~~~~~~al~ff~~~~~~~~~~~~--~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~----  142 (766)
                      ..+++..|+.+|......+ +.|+  ....++....+.+.+..+..+...++..+... ...+.+.+...+..++.    
T Consensus        63 ~~g~~~~A~~l~~~m~~~g-~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~-~~~~~n~li~~~~~~g~~~~A  140 (857)
T PLN03077         63 SHGQLEQALKLLESMQELR-VPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSL-GVRLGNAMLSMFVRFGELVHA  140 (857)
T ss_pred             hCCCHHHHHHHHHHHHhcC-CCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCC-CchHHHHHHHHHHhCCChHHH
Confidence            3567999999999887643 3333  33445666777788888888888777666543 23455666665544432    


Q ss_pred             --------CCcHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHHcCCCCcHHHHHHHHHHHhhCC
Q 004231          143 --------TSSSAVIDLVVKSYSHLNMIDKAVNIVNLAKVHGFMPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSR  214 (766)
Q Consensus       143 --------~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~ll~~~~~~~~~~~~~~a~~~~~~m~~~g  214 (766)
                              .++..+|+.+|.+|++.|++++|+.+|++|...|+.||.++|+.++.+|++.+.   +..+.+++..|.+.|
T Consensus       141 ~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~---~~~~~~~~~~~~~~g  217 (857)
T PLN03077        141 WYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPD---LARGREVHAHVVRFG  217 (857)
T ss_pred             HHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccc---hhhHHHHHHHHHHcC
Confidence                    135568999999999999999999999999999999999999999999988773   388999999999999


Q ss_pred             CCCCHHHHHHHHHHHHhcCChhhHHHHHHHHHhCCCCcCHHHHHHHHHHHHHcCChhHHHHHHHHHhhCCCCCCHHHHHH
Q 004231          215 VSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNV  294 (766)
Q Consensus       215 ~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~~~~~  294 (766)
                      +.||..+||++|.+|++.|+++.|.++|++|.+    ||+++||++|.+|++.|++++|+++|++|...|+.||..||+.
T Consensus       218 ~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~----~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~  293 (857)
T PLN03077        218 FELDVDVVNALITMYVKCGDVVSARLVFDRMPR----RDCISWNAMISGYFENGECLEGLELFFTMRELSVDPDLMTITS  293 (857)
T ss_pred             CCcccchHhHHHHHHhcCCCHHHHHHHHhcCCC----CCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHH
Confidence            999999999999999999999999999999974    6889999999999999999999999999999999999999999


Q ss_pred             HHHHHHHcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCChHHHHHHHHHHHhcCC
Q 004231          295 IINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGN  374 (766)
Q Consensus       295 li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~  374 (766)
                      ++.++++.|+.+.|.+++..|.+.|+.||..+|++|+.+|++.|++++|.++|++|.    .||..+|+++|.+|++.|+
T Consensus       294 ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~----~~d~~s~n~li~~~~~~g~  369 (857)
T PLN03077        294 VISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRME----TKDAVSWTAMISGYEKNGL  369 (857)
T ss_pred             HHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCC----CCCeeeHHHHHHHHHhCCC
Confidence            999999999999999999999999999999999999999999999999999999986    4689999999999999999


Q ss_pred             HHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHH
Q 004231          375 LNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHG  454 (766)
Q Consensus       375 ~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~l~~~m~~~g~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~  454 (766)
                      +++|.++|++|.+.|+.||..||+.++.+|++.|++++|.++++.|.+.|+.|+..+|+.|+++|++.|++++|.++|++
T Consensus       370 ~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~  449 (857)
T PLN03077        370 PDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHN  449 (857)
T ss_pred             HHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCH
Q 004231          455 MARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDE  534 (766)
Q Consensus       455 ~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~  534 (766)
                      |.+    +|..+|+.+|.+|++.|+.++|+.+|++|.. ++.||..||+.++.+|++.|+.+.+.+++..+.+.|+.+|.
T Consensus       450 m~~----~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~~~~~  524 (857)
T PLN03077        450 IPE----KDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGFDG  524 (857)
T ss_pred             CCC----CCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCCCccc
Confidence            865    5888999999999999999999999999986 68999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCcHHhHHHHhhhh
Q 004231          535 FTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENC  614 (766)
Q Consensus       535 ~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p~~~~~~~li~~~~~~g~~~~A~~l~~~~~~~~~~p~~~~~~~ll~~~  614 (766)
                      .++++|+.+|++.|++++|.++|+++     .||..+|+++|.+|++.|+.++|.++|++|.+.|+.||..||+.++   
T Consensus       525 ~~~naLi~~y~k~G~~~~A~~~f~~~-----~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll---  596 (857)
T PLN03077        525 FLPNALLDLYVRCGRMNYAWNQFNSH-----EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLL---  596 (857)
T ss_pred             eechHHHHHHHHcCCHHHHHHHHHhc-----CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHH---
Confidence            99999999999999999999999887     5799999999999999999999999999999999999999999999   


Q ss_pred             chhhhhhHHHHHhhhhhcCCHHHHHHHHHHHH-hCCCCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCCHHHHH
Q 004231          615 TNIEFQNVAALLKGFCMKGLMNEADRVFELML-QRNHMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTII  693 (766)
Q Consensus       615 ~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~-~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~  693 (766)
                                  .+|++.|++++|.++|+.|. +.|+.|+..+|+.++++|++.|++++|.+++++|   ++.||..+|.
T Consensus       597 ------------~a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m---~~~pd~~~~~  661 (857)
T PLN03077        597 ------------CACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKM---PITPDPAVWG  661 (857)
T ss_pred             ------------HHHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHC---CCCCCHHHHH
Confidence                        89999999999999999999 7899999999999999999999999999999999   4789999999


Q ss_pred             HHHHHHHhcCChHHHHHHHHHHHHcCCCChHHHHHHHHHHHhcCCChhHHHHHHHHHHHCCCCCCCCCCCCC
Q 004231          694 VLVKALHTAGMNEELSQVIENILRSCRLSDAELAKVLVEINHKEGNMDAVLNVLTEMAKDGLLPNSGRSTYG  765 (766)
Q Consensus       694 ~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~  765 (766)
                      +|+.+|...|+.+.|....+++++.. |.+...|..|.+.|...|+|++|.++++.|.++|++|++|+||+.
T Consensus       662 aLl~ac~~~~~~e~~e~~a~~l~~l~-p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie  732 (857)
T PLN03077        662 ALLNACRIHRHVELGELAAQHIFELD-PNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVE  732 (857)
T ss_pred             HHHHHHHHcCChHHHHHHHHHHHhhC-CCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEE
Confidence            99999999999999999999999987 677888999999999999999999999999999999999999973



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG2297 consensus Predicted translation factor, contains W2 domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF07575 Nucleopor_Nup85: Nup85 Nucleoporin; InterPro: IPR011502 This is a family of nucleoporins conserved from yeast to human Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query766
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-22
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-21
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-20
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-05
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score =  102 bits (253), Expect = 2e-22
 Identities = 45/346 (13%), Positives = 108/346 (31%), Gaps = 13/346 (3%)

Query: 374 NLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLDEAYRLLNEMTKNGFMPSIVTYN 433
           +   A    D        P E+    L+        LD       + ++           
Sbjct: 72  SKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLL 131

Query: 434 ALIKGHCTGGRVEDAVGVL---HGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREM 490
           A  K      ++  A  +L   HG  +K     +  Y+ ++ G++R     +       +
Sbjct: 132 AFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMV 191

Query: 491 VEKGVLPDTITYSSLIHGLCEQRRITEACE-LFQEMLSRGMSPDEFTYTTLINAYCTEGD 549
            + G+ PD ++Y++ +  +  Q +     E   ++M   G+         L++       
Sbjct: 192 KDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATV 251

Query: 550 IPQALRLHDEMIQKGFLPDVVTYSVLINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNT 609
           +    ++         LP  V  S L+  +  +   +   KL L L   + +    ++  
Sbjct: 252 LKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH-- 309

Query: 610 LIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRNHMPNEAVYDIIIHGHSKVGN 669
            +E  + +   +V         K + +    +  L  Q       A+ +       +V  
Sbjct: 310 -MELASRVCVVSVEKPTL--PSKEVKHARKTLKTLRDQWEKALCRALRETKNRLEREVYE 366

Query: 670 VQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENI 715
            + +   +  ++        V  ++L          E  + +   +
Sbjct: 367 GRFSLYPFLCLLD----EREVVRMLLQVLQALPAQGESFTTLAREL 408


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.97
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.92
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.91
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.87
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.85
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.85
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.85
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.83
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.8
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.79
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.78
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.77
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.75
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.75
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.74
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.73
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.72
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.65
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.63
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.6
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.59
3u4t_A272 TPR repeat-containing protein; structural genomics 99.58
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.58
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.57
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.56
3u4t_A272 TPR repeat-containing protein; structural genomics 99.55
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.55
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.54
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.53
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.53
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.51
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.51
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.5
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.5
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.48
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.45
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.45
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.44
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.44
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.42
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.41
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.41
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.4
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.39
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.39
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.36
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.31
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.3
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.25
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.24
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.24
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.22
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.2
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.2
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.16
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.13
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.09
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.04
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.99
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.98
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.98
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.97
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.97
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.96
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.95
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.93
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.93
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.92
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.91
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.86
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.85
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.83
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.82
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.81
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.8
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.8
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.8
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.8
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.78
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.75
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.74
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.73
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.73
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.72
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.71
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.67
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.67
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.62
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.61
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.57
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.57
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.56
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.56
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.54
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.54
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.53
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.51
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.51
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.48
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.48
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.46
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.45
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.45
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.42
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.42
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.39
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.38
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.37
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.36
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.32
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.32
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.31
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.29
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.28
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.27
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.26
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.25
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.25
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.25
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.25
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.24
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.24
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.23
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.19
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.19
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.16
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.16
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.14
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.11
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.08
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.08
3k9i_A117 BH0479 protein; putative protein binding protein, 98.06
3k9i_A117 BH0479 protein; putative protein binding protein, 98.06
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.03
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.03
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.02
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.0
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.0
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.98
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.96
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.95
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.92
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.9
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.9
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 97.86
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.74
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.73
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.68
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.64
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.6
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.6
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.49
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.48
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.46
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.46
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.43
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.42
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.36
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.25
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.2
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.18
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.03
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.0
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.85
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.82
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.81
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.66
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.6
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.55
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.51
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.34
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.31
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.3
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.15
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.1
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.08
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.96
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.84
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 95.7
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 95.1
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.66
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.45
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.31
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.18
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.98
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 93.84
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.41
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 93.33
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 92.28
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 91.61
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 91.55
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.48
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.45
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 91.15
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 90.4
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 90.08
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 89.8
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 88.85
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 88.57
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 88.16
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 87.97
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.23
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 86.88
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 86.34
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 85.89
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 85.82
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 84.72
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 80.88
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.9e-40  Score=374.77  Aligned_cols=506  Identities=12%  Similarity=0.030  Sum_probs=359.6

Q ss_pred             CCCHhhHHHHHHHHHHcCCCCcHHHHHHHHHHHhhCCCCCCHHHHHHHHHHHHhcCChhhHHHHHHHHHhCCCCcCHHHH
Q 004231          178 MPGVLSYNAILDSVIRSGRNNWVKFAEEVYNEMGKSRVSPNVYTYNVLIRGFCGVGDLEMGLRFFSEMEKNNCLANVVTY  257 (766)
Q Consensus       178 ~~~~~~~~~ll~~~~~~~~~~~~~~a~~~~~~m~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~~~~~~~  257 (766)
                      .++...|+.++..+.+.|+   +++|..+|++|...  .|+..++..++.+|.+.|++++|..+|+.+...  +++..++
T Consensus        81 ~~~~~~~~~~~~~~~~~g~---~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~  153 (597)
T 2xpi_A           81 LSREDYLRLWRHDALMQQQ---YKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLY--NRSSACR  153 (597)
T ss_dssp             -CHHHHHHHHHHHHHHTTC---HHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGG--GTCHHHH
T ss_pred             HHHHHHHHHHHHHHHHccC---chHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHHHHHHHHhcc--ccchhHH
Confidence            3677788888888888874   38888888888753  567788888888888888888888888877543  5677888


Q ss_pred             HHHHHHHHHcCChhHHHHHHHHHhhCCCCCCHHHHHHHHHHHHHcCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhc
Q 004231          258 NTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLISYNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKE  337 (766)
Q Consensus       258 ~~li~~~~~~g~~~~A~~l~~~m~~~g~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~~~~~~li~~~~~~  337 (766)
                      +.++.+|++.|++++|.++|+++..     +..    ...++.+.++           ...+..++..+|+.++.+|.+.
T Consensus       154 ~~l~~~~~~~g~~~~A~~~~~~~~~-----~~~----~~~~~~~~~~-----------~~~~~~~~~~~~~~l~~~~~~~  213 (597)
T 2xpi_A          154 YLAAFCLVKLYDWQGALNLLGETNP-----FRK----DEKNANKLLM-----------QDGGIKLEASMCYLRGQVYTNL  213 (597)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHCSSCT-----TC--------------C-----------CCSSCCHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHhhHHHHHHHHhccCC-----ccc----cccccccccc-----------cccccchhHHHHHHHHHHHHHc
Confidence            8888888888888888888875321     110    0000001000           1123344566666777777777


Q ss_pred             CChHHHHHHHHHHHHCCCCCChHHHHHHHHHHHhcCCHHHHH--HH-HHHHHHCCCCCCHhHHHHHHHHHHhcCCHHHHH
Q 004231          338 GNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAM--EF-FDQMHVRELRPNEKTYTTLINGFSQHGFLDEAY  414 (766)
Q Consensus       338 g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~--~~-~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~  414 (766)
                      |++++|.++|+++.+.+ +.+...+..+...+...+..+.+.  .+ +..+...+..+...+|+.++..|.+.|++++|.
T Consensus       214 g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~  292 (597)
T 2xpi_A          214 SNFDRAKECYKEALMVD-AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAE  292 (597)
T ss_dssp             TCHHHHHHHHHHHHHHC-TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHhC-chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHH
Confidence            77777777777766653 124444554544443332222211  11 344444433444555666677777777777777


Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHHHHCC
Q 004231          415 RLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREMVEKG  494 (766)
Q Consensus       415 ~l~~~m~~~g~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~  494 (766)
                      ++|+++.+.  +++..+++.++.+|.+.|++++|..+|+++.+.+.. +..+++.++.+|.+.|++++|.++++++.+..
T Consensus       293 ~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~-~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  369 (597)
T 2xpi_A          293 DYLSSINGL--EKSSDLLLCKADTLFVRSRFIDVLAITTKILEIDPY-NLDVYPLHLASLHESGEKNKLYLISNDLVDRH  369 (597)
T ss_dssp             HHHHTSTTG--GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTT-CCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHC
T ss_pred             HHHHHhhcC--CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCcc-cHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhC
Confidence            777777654  467777777777777777777777777777765433 66677777777777777777777777777543


Q ss_pred             CCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHHHHHH
Q 004231          495 VLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVVTYSV  574 (766)
Q Consensus       495 ~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p~~~~~~~  574 (766)
                       +.+..+|..++..|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.+ +.+..+|..
T Consensus       370 -~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~  446 (597)
T 2xpi_A          370 -PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLF-QGTHLPYLF  446 (597)
T ss_dssp             -TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTT-TTCSHHHHH
T ss_pred             -cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-ccchHHHHH
Confidence             3367777777777888888888888888777653 4456777888888888888888888888877652 456777888


Q ss_pred             HHHHHHhcCCHHHHHHHHHHHHhCCCCCcHHhHHHHhhhhchhhhhhHHHHHhhhhhcCCHHHHHHHHHHHHhC----CC
Q 004231          575 LINGLNKQARTMEAKKLLLKLFYDESVPSDVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQR----NH  650 (766)
Q Consensus       575 li~~~~~~g~~~~A~~l~~~~~~~~~~p~~~~~~~ll~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~----~~  650 (766)
                      ++.+|.+.|++++|.++|+++.+. .+.+..+|..+.               ..|.+.|++++|.++|+++.+.    +.
T Consensus       447 l~~~~~~~g~~~~A~~~~~~~~~~-~~~~~~~~~~l~---------------~~~~~~g~~~~A~~~~~~~~~~~~~~~~  510 (597)
T 2xpi_A          447 LGMQHMQLGNILLANEYLQSSYAL-FQYDPLLLNELG---------------VVAFNKSDMQTAINHFQNALLLVKKTQS  510 (597)
T ss_dssp             HHHHHHHHTCHHHHHHHHHHHHHH-CCCCHHHHHHHH---------------HHHHHTTCHHHHHHHHHHHHHHHHHSCC
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHHh-CCCChHHHHHHH---------------HHHHHhCCHHHHHHHHHHHHHhhhcccc
Confidence            888888888888888888888764 233566677766               7888888888888888888764    55


Q ss_pred             CCC--HHHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCChHHHHH
Q 004231          651 MPN--EAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPHTVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAK  728 (766)
Q Consensus       651 ~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~  728 (766)
                      .|+  ..+|..++.+|.+.|++++|++.++++.+.+ +.+..+|..++.+|...|++++|..+++++++.+ |.+...+.
T Consensus       511 ~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~~~-p~~~~~~~  588 (597)
T 2xpi_A          511 NEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLAIS-PNEIMASD  588 (597)
T ss_dssp             CSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCHHHHH
T ss_pred             chhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHhcC-CCChHHHH
Confidence            776  7899999999999999999999999998764 4467899999999999999999999999999998 66788888


Q ss_pred             HHHHHHh
Q 004231          729 VLVEINH  735 (766)
Q Consensus       729 ~l~~~~~  735 (766)
                      .++.+|.
T Consensus       589 ~l~~~~~  595 (597)
T 2xpi_A          589 LLKRALE  595 (597)
T ss_dssp             HHHHTTC
T ss_pred             HHHHHHh
Confidence            8887764



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 766
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.0 bits (97), Expect = 2e-04
 Identities = 59/366 (16%), Positives = 113/366 (30%), Gaps = 18/366 (4%)

Query: 233 GDLEMGLRFFSEMEKNNCLANVVTYNTLIDGYCKLGRIDDAFKLLRDMGLKGIEPNLI-S 291
           GD E   R   ++ +     N      L   + +  R+D +        +K   P L  +
Sbjct: 13  GDFEAAERHCMQLWRQEP-DNTGVLLLLSSIHFQCRRLDRSAHFSTLA-IK-QNPLLAEA 69

Query: 292 YNVIINGLCKEGRLKETKGILNEISRKGLVPDEVTYNTLLNGYCKEGNLHQALVLHAEMV 351
           Y+ + N   + G+L+E         R      +   N                   + + 
Sbjct: 70  YSNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQ 129

Query: 352 RNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFLD 411
            N     V +    +          +A                  ++ L   F+  G + 
Sbjct: 130 YNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPN---FAVAWSNLGCVFNAQGEIW 186

Query: 412 EAYRLLNEMTKNGFMPSIV-TYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTI 470
            A     +       P+ +  Y  L          + AV               V +  +
Sbjct: 187 LAIHHFEKAVT--LDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAVVHGNL 243

Query: 471 ISGFSRSQELDKAFDTKREMVEKGVLPD-TITYSSLIHGLCEQRRITEACELFQEMLSRG 529
              +     +D A DT R  +E    P     Y +L + L E+  + EA + +   L   
Sbjct: 244 ACVYYEQGLIDLAIDTYRRAIELQ--PHFPDAYCNLANALKEKGSVAEAEDCYNTALRL- 300

Query: 530 MSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPD-VVTYSVLINGLNKQARTMEA 588
                 +   L N    +G+I +A+RL+ + ++    P+    +S L + L +Q +  EA
Sbjct: 301 CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVF--PEFAAAHSNLASVLQQQGKLQEA 358

Query: 589 KKLLLK 594
                +
Sbjct: 359 LMHYKE 364


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query766
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.92
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.57
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.23
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.17
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.11
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.1
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.05
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.05
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.02
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.98
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.98
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.94
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.67
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.62
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.61
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.55
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.51
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.5
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.46
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.42
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.33
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.32
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.29
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.19
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.15
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.14
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.13
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.11
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.06
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.0
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.95
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.92
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.9
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.89
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.88
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.86
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.77
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.67
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.65
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.64
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.58
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.4
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.38
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.24
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.15
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.08
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.06
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.86
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.23
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.88
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.65
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.56
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.3
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 86.01
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=4.8e-21  Score=200.09  Aligned_cols=381  Identities=16%  Similarity=0.092  Sum_probs=270.7

Q ss_pred             HHHHHhcCChHHHHHHHHHHHHCCCCCChHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHhHHHHHHHHHHhcCCH
Q 004231          331 LNGYCKEGNLHQALVLHAEMVRNGLSPNVVTYTSLINSMCKSGNLNRAMEFFDQMHVRELRPNEKTYTTLINGFSQHGFL  410 (766)
Q Consensus       331 i~~~~~~g~~~~A~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~  410 (766)
                      ...+.+.|++++|.+.++++.+.. +-+...+..+...|.+.|++++|...|++..+..+ -+..+|..+...+.+.|++
T Consensus         6 a~~~~~~G~~~~A~~~~~~~l~~~-p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p-~~~~a~~~l~~~~~~~g~~   83 (388)
T d1w3ba_           6 AHREYQAGDFEAAERHCMQLWRQE-PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNP-LLAEAYSNLGNVYKERGQL   83 (388)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHTCH
T ss_pred             HHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCC-CCHHHHHHHHHHhhhhccc
Confidence            344556667777777776666542 22456666666667777777777777776666532 2456666677777777777


Q ss_pred             HHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHccCCHHHHHHHHHHH
Q 004231          411 DEAYRLLNEMTKNGFMPSIVTYNALIKGHCTGGRVEDAVGVLHGMARKGLAPDVVSYSTIISGFSRSQELDKAFDTKREM  490 (766)
Q Consensus       411 ~~A~~l~~~m~~~g~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m  490 (766)
                      ++|...+....+.. +.+..............+....+............. ...............+....+...+.+.
T Consensus        84 ~~A~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (388)
T d1w3ba_          84 QEAIEHYRHALRLK-PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPD-LYCVRSDLGNLLKALGRLEEAKACYLKA  161 (388)
T ss_dssp             HHHHHHHHHHHHHC-TTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTT-CTHHHHHHHHHHHTTSCHHHHHHHHHHH
T ss_pred             cccccccccccccc-cccccccccccccccccccccccccccccccccccc-cccccccccccccccchhhhhHHHHHHh
Confidence            77777777766643 223333333333444444444444444444443222 3444445555666777777777777776


Q ss_pred             HHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCChHHHHHHHHHHHHCCCCCCHH
Q 004231          491 VEKGVLPDTITYSSLIHGLCEQRRITEACELFQEMLSRGMSPDEFTYTTLINAYCTEGDIPQALRLHDEMIQKGFLPDVV  570 (766)
Q Consensus       491 ~~~~~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~g~~p~~~  570 (766)
                      ...... +...+..+...+...|++++|...+++..+.. +.+...+..+...+...|++++|...++.....+ +.+..
T Consensus       162 ~~~~~~-~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~  238 (388)
T d1w3ba_         162 IETQPN-FAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS-PNHAV  238 (388)
T ss_dssp             HHHCTT-CHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC-TTCHH
T ss_pred             hccCcc-hhHHHHhhcccccccCcHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh-hhHHH
Confidence            665422 56677777778888888888888888887764 4456678888888888899999998888887753 45667


Q ss_pred             HHHHHHHHHHhcCCHHHHHHHHHHHHhCCCCCc-HHhHHHHhhhhchhhhhhHHHHHhhhhhcCCHHHHHHHHHHHHhCC
Q 004231          571 TYSVLINGLNKQARTMEAKKLLLKLFYDESVPS-DVIYNTLIENCTNIEFQNVAALLKGFCMKGLMNEADRVFELMLQRN  649 (766)
Q Consensus       571 ~~~~li~~~~~~g~~~~A~~l~~~~~~~~~~p~-~~~~~~ll~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~  649 (766)
                      .+..+...+.+.|++++|.+.|++.++.  .|+ ...+..+.               ..+...|++++|++.++......
T Consensus       239 ~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~---------------~~~~~~~~~~~A~~~~~~~~~~~  301 (388)
T d1w3ba_         239 VHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLA---------------NALKEKGSVAEAEDCYNTALRLC  301 (388)
T ss_dssp             HHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHH---------------HHHHHHSCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHH---------------HHHHHcCCHHHHHHHHHhhhccC
Confidence            7778888888899999999999988874  344 34455554               78888999999999999888742


Q ss_pred             CCCCHHHHHHHHHHHhccCChHHHHHHHHHHHHcCCCCC-HHHHHHHHHHHHhcCChHHHHHHHHHHHHcCCCChHHHHH
Q 004231          650 HMPNEAVYDIIIHGHSKVGNVQKAYDLYKKMVRSGFVPH-TVTIIVLVKALHTAGMNEELSQVIENILRSCRLSDAELAK  728 (766)
Q Consensus       650 ~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~m~~~~~~p~-~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~  728 (766)
                       +.+...+..++..+.+.|++++|++.++++++.  .|+ ..++..++..+...|++++|+..++++++.+ |.+...|.
T Consensus       302 -~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~-P~~~~a~~  377 (388)
T d1w3ba_         302 -PTHADSLNNLANIKREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRIS-PTFADAYS  377 (388)
T ss_dssp             -TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTC-TTCHHHHH
T ss_pred             -CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCCHHHHH
Confidence             347788888999999999999999999998853  454 4678889999999999999999999999987 66788889


Q ss_pred             HHHHHHhcCCC
Q 004231          729 VLVEINHKEGN  739 (766)
Q Consensus       729 ~l~~~~~~~g~  739 (766)
                      .++.+|.+.|+
T Consensus       378 ~lg~~~~~~~D  388 (388)
T d1w3ba_         378 NMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHHHTCC
T ss_pred             HHHHHHHHcCC
Confidence            99999988875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure