Citrus Sinensis ID: 004256

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-----
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPEQQNQQPPPPPPPQNQDSGEEEQNEEEDQEDENDEENEQQQEQLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDVGRIMIVAITDGRANISLKRSTDPEATASDAPRPSSQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISATTKDALSALKNS
cccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccccEEEcccccccccccccccccccHHHHHcccccccccccccccEEEcccccccccccccccHHHHHHcccccccccccccccccEEEEEccccccHHHHHHHHHHHHcccCEEEEcccccccccccEEEECcccccccccHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHcccHHHHHHHccccccccEEEcccHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEECcccEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHcccEEccccccHHHHHHHHHHHHHHHHcc
****************************VSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHV***************************RQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPR***************************************************************LVDEKLLFFAQQ**********AKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPY****************VEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDVGRIMIVAITDGRANISLKR***************SQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISATT**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFSSTITTTVSSAASTSLSHLQQSCSVVSSLKLHPLLFSYSPPPFFKFRTRPKHHRFFHVRASSSNATLDSANGAVAAASEDQDSYGRQFFPLAAVVGQDAIKTALLLGAIDREIGGIAISGRRGTAKTVMARGLHAILPPIEVVVGSIANADPTCPDEWEDGLDEKAEYDTAGNLKTQIARSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYIDEINLLDEGISNLLLNVLTEGVNIVEREGISFKHPCKPLLIATYNPEEGVVREHLLDRIAINLSADLPMTFEDRVAAVGIATQFQERSNEVFKMVEEETDLAKTQIILAREYLKDVAIGREQLKYLVMEALRGGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINETPPEQQNQQPPPPPPPQNQDSxxxxxxxxxxxxxxxxxxxxxxxxxLPEEFIFDAEGGLVDEKLLFFAQQAQRRRGKAGRAKNVIFSEDRGRYIKPMLPKGPIKRLAVDATLRAAAPYQKLRRERDTQKTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAESYTCRDQVSIIPFRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLSMAVRVGLNAEKSGDVGRIMIVAITDGRANISLKRSTDPEATASDAPRPSSQELKDEILEVAGKIYKAGMSLLVIDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISATTKDALSALKNS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Magnesium-chelatase subunit ChlD, chloroplastic Involved in chlorophyll biosynthesis. Catalyzes the insertion of magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX. The reaction takes place in two steps, with an ATP-dependent activation followed by an ATP-dependent chelation step.confidentQ6ATS0
Magnesium-chelatase subunit ChlD, chloroplastic Involved in chlorophyll biosynthesis; introduces a magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX.confidentQ9SJE1
Magnesium-chelatase subunit ChlD, chloroplastic Involved in chlorophyll biosynthesis; introduces a magnesium ion into protoporphyrin IX to yield Mg-protoporphyrin IX.probableO24133

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.6.-.-Forming nitrogen-metal bonds.probable
6.6.1.-Forming coordination complexes.probable
6.6.1.1Magnesium chelatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G8P, chain A
Confidence level:very confident
Coverage over the Query: 89-408
View the alignment between query and template
View the model in PyMOL
Template: 2X31, chain A
Confidence level:very confident
Coverage over the Query: 558-759
View the alignment between query and template
View the model in PyMOL
Template: 3DZD, chain A
Confidence level:very confident
Coverage over the Query: 21-142,183-360
View the alignment between query and template
View the model in PyMOL
Template: 3HU3, chain A
Confidence level:confident
Coverage over the Query: 21-141,184-203,214-252,264-317,340-403
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3cx5, chain Fprobable Alignment | Template Structure